Welcome

You Can Pay More... but at Pearces, You Don't Have To!

We hope your like our new website. The enhanced technology you see here will allow us to better serve you. We intend to use this new technology to further enhance the shopping experience at Pearce's now and in the future with even more conveniences. We heartily encourage your input. We need your feed back to improve. Please use this website to shop Pearce's at YOUR convenience no matter what the time of day or the price of gas. 

Here is what you can currently do:

You can use this site to get your interior design questions answered by our specialist that have over 250 years combined experience in the home furnishing industry. Just email your questions to us from the "CONTACT US" link, or if it is during business hours, just give us a call.

You can preview "PEARCE'S SPECIALS" before they are advertised anywhere else. We use our volume to encourage the best possible price from our vendors, and pass these saving on to you. From time to time, we have special purchases that are extremely discounted, even for us. Now, you can see these specials in some cases before they even make it to our showrooms. Please remember, because of competition agreements with our premium vendors, we can not usually advertise price.

You can read what our customers have to say by reading "WHAT OUR CUSTOMERS HAVE TO SAY."

These are a few of the things that have changed at Pearce's. The things that have not changed are our commitment to quality and service. By continuing to use our volume to deliver you the best possible, pricing we are still able to offer "FREE DELIVERY" to our customers within a 100 mile radius.




Debugging Information
ColdFusion Server Enterprise 11,0,02,291725
Template /index.cfm
Time Stamp 21-Jul-19 01:26 PM
Locale English (US)
User Agent CCBot/2.0 (https://commoncrawl.org/faq/)
Remote IP 35.171.183.163
Host Name 35.171.183.163


Execution Time

Total Time Avg Time Count Template
7539 ms 685 ms 11 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc | handle(CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc
4219 ms 4219 ms 1 C:/inetpub/wwwroot/clients/mura7/index.cfm
4219 ms 4219 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc | handleRootRequest() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc
4217 ms 4217 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc | parseURLRoot(path = /) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc
3558 ms 3558 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardDoResponseHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
3558 ms 3558 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardDoResponseHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3466 ms 3466 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardTranslationHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
3466 ms 3466 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardTranslationHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3450 ms 3450 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc | translate(CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc
3449 ms 3449 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Translator/standardHTMLTranslator.cfc | translate(mura = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, m = CFC: mura.MuraScope, event = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Translator/standardHTMLTranslator.cfc
3265 ms 3265 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/two_column_SR - home.cfm
1142 ms 1142 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/inc/navbar.cfm
895 ms 895 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(interval = 5000, showCaption = true, autoStart = true, size = carousel, feedName = carousel, cssID = myCarousel) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
887 ms 887 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspCarouselByFeedName) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
809 ms 809 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(liHasKidsClass = dropdown, liClass = nav-item, aCurrentClass = nav-link active, aNotCurrentClass = nav-link, liHasKidsAttributes = , displayHome = always, liCurrentClass = , viewDepth = 1, class = navbar-nav mr-auto, liCurrentAttributes = , siteid = pearcesfurniture, closeFolders = true, liHasKidsNestedClass = , aHasKidsClass = dropdown-toggle, showCurrentChildrenOnly = false, ulNestedAttributes = , id = navPrimary, aCurrentAttributes = , ulNestedClass = dropdown-menu, aHasKidsAttributes = ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
803 ms 803 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspPrimaryNav) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
802 ms 802 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspNestedNavPrimary(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
779 ms 779 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(2) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
774 ms 774 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspObjects) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
772 ms 772 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | dspObjects(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
745 ms 373 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | dspObject(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
683 ms 342 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspObject_Render(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
637 ms 127 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getIterator() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
591 ms 148 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspPrimaryNavKids(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
461 ms 92 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc | getFeed(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc
455 ms 91 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedGateway.cfc | getFeed(applyPermFilter = false, feedBean = CFC: mura.content.feed.feedBean, applyIntervals = true, tag = , from = , to = , countOnly = false, aggregation = false, menuType = default) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedGateway.cfc
418 ms 418 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspObject(objectid = 93BC28E7-155D-6942-024F839DCE550B35, returnformat = default, objectname = component, RenderingAsRegion = true, orderno = 1, assignmentPerm = read, hasConfigurator = 0, params = {"object":"component","objecticonclass":"mi-clone","objectname":"","render":"server","cssid":"","class":"","contentcssid":"","inited":"YES","contentcssstyles":{},"metacssstyles":{},"contentcssclass":"","cssclass":"","cssstyles":{}}, assignmentid = 942DF1F7-155D-6942-02D12D1BD469D287, object = component, siteid = pearcesfurniture, regionid = 2) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
385 ms 193 ms 2 C:/inetpub/wwwroot/clients/mura7/core/modules/v1/component/index.cfm
349 ms 349 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetContentRendererHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
349 ms 175 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getContentRenderer() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
349 ms 349 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetContentRendererHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
329 ms 329 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspObject(objectid = 93109571-155D-6942-02F46FECAEE09D6F, returnformat = default, objectname = component, RenderingAsRegion = true, orderno = 2, assignmentPerm = read, hasConfigurator = 0, params = {"object":"component","objecticonclass":"mi-clone","objectname":"","render":"server","cssid":"","class":"","contentcssid":"","inited":"YES","contentcssstyles":{},"metacssstyles":{},"contentcssclass":"","cssclass":"","cssstyles":{}}, assignmentid = 942DF1F7-155D-6942-02D12D1BD469D287, object = component, siteid = pearcesfurniture, regionid = 2) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
320 ms 27 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getImageURL(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
270 ms 39 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getURL(CFC: mura.content.contentNavBean, , false, 0, false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
233 ms 47 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
233 ms 16 ms 15 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | createHREF(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
206 ms 206 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(pageTitle = , showMetaImage = false, crumbList = false, body = <h1>Welcome</h1>

<em><strong>You Can Pay More... but at Pearces, You Don't Have To!</strong></em>

We hope your like our&nbsp;new website. The enhanced technology you see here will allow us to better serve&nbsp;you. We intend to use this new technology to further enhance the shopping experience at Pearce's now and in the future with even more conveniences. We heartily encourage your input. We need your feed back to&nbsp;improve. Please use this website to shop Pearce's at YOUR convenience no matter what the time of day or the price of gas.&nbsp;

Here is what you can currently do:

You can use this site to get your interior design questions answered by our&nbsp;specialist that have over 250 years combined experience in the home furnishing industry. Just email your questions to us from the <strong>"CONTACT US"</strong> link, or if it is during business hours, just give us a call.

You can preview <strong>"PEARCE'S SPECIALS"</strong> before they are advertised anywhere else. We use our&nbsp;volume to encourage the best possible price from our&nbsp;vendors, and pass these saving on to you. From time to time, we have special purchases that&nbsp;are extremely discounted, even for us. Now, you can see these specials in some cases before they even make it to our showrooms. Please remember, because of competition agreements with our&nbsp;premium&nbsp;vendors, we can not usually advertise price.

You can read what our&nbsp;customers have to say by reading <strong>"WHAT OUR CUSTOMERS HAVE TO SAY."</strong>

These are a few of the things that have changed at Pearce's. The things that have not changed are our commitment to quality and service. By continuing to use our&nbsp;volume to deliver you the best possible, pricing we are still able to offer <strong>"FREE DELIVERY"</strong> to our&nbsp;customers within a 100 mile radius.

<hr>) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
201 ms 201 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspBody) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
193 ms 193 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodName = getCurrentURLArray) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
192 ms 192 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | getCurrentURLArray(renderer = CFC: muraWRM.sites.pearcesfurniture.contentRenderer) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
190 ms 32 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getImageURL(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
186 ms 16 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/fileManager.cfc | createHREFForImage(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/fileManager.cfc
181 ms 6 ms 30 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
173 ms 29 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getURL() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
167 ms 28 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentIterator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
167 ms 13 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentNavBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
160 ms 160 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getCrumbPropertyArray(property = url, direction = desc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
140 ms 23 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
140 ms 23 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getImageURL() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
137 ms 137 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | lookupCustomContentTypeBody(CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
124 ms 25 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | addlink(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
120 ms 120 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | renderHTMLQueue(Head) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
117 ms 1 ms 105 C:/inetpub/wwwroot/clients/mura7/core/mura/backport/backport.cfm
110 ms 55 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(theFile = extensions/dsp_Component_Default.cfm, throwError = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
107 ms 9 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(themeAssetPath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
104 ms 104 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(url) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
101 ms 101 ms 1 C:/inetpub/wwwroot/clients/mura7/core/modules/v1/htmlhead/global.cfm
101 ms 51 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | createHREF(filename = ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
98 ms 98 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/inc/html_head.cfm
98 ms 49 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getAllValues() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
97 ms 49 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | dspObject_include(theFile = object/meta.cfm, params = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
95 ms 48 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspObject_include) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
93 ms 93 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetContentHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
93 ms 93 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetContentHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
86 ms 86 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/Application.cfc | onRequestStart(/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/Application.cfc
85 ms 85 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | renderObjectInManager(objectid = 93BC28E7-155D-6942-024F839DCE550B35, returnformat = default, renderer = CFC: muraWRM.sites.pearcesfurniture.contentRenderer, objectname = , objectParams = [complex value], content = <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/universal.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/riverside.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/vaughan-bassett-furniture(1).png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/SignatureDesign_black_Logo.jpg" style="width:100%" /></div> <hr />, object = component, showEditable = false, bodyRender = false, isConfigurator = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
83 ms 14 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(IncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
81 ms 81 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | renderObjectInManager(objectid = 93109571-155D-6942-02F46FECAEE09D6F, returnformat = default, renderer = CFC: muraWRM.sites.pearcesfurniture.contentRenderer, objectname = , objectParams = [complex value], content = <div class="lightbox"> <h3 style="text-align: center;"><strong>What Our Customers Have to Say:</strong></h3> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Robinson</h4> <h5 style="text-align: center;">Atlanta / Townsend, GA</h5>

When we decided to build a second home in McIntosh County, we asked around as to where to shop for furniture.&quot; We were directed to Odum, GA to Pearces. We were&nbsp;very pleased with the store and with our sales person, Pam. Delivery&nbsp;- they called ahead and were right on target. I highly recommend Pearces Furniture!.&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hathaway</h4> <h5 style="text-align: center;">Richmond Hill, GA</h5>

&quot;We have&nbsp;been shopping at Pearces a&nbsp;<u>long time.</u>&nbsp;My husband grew up in that&nbsp;area and knows&nbsp;the Pearce family. We have been satisfied&nbsp;with everything we have ever purchased there.&nbsp;They're on&nbsp;time and pleasant with delivery.&nbsp;I have had special orders which always worked great - if I was ever looking for something and didn't see it, they brought out the books and helped me find it and ordered it for me (providing it was available, of course).&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Pollard</h4> <h5 style="text-align: center;">Odum, GA</h5>

&quot;We have purchased furniture from Pearces on multiple occasions, the most recent being while we remodeled our home. They were&nbsp;<u>very</u>&nbsp;accomodating and worked with us on our time frame. We will definitely go back. 'Against the competition?......They are definitely on top!&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hicks</h4> <h5 style="text-align: center;">Keystone Heights, FL</h5>

&quot;Most all of the furniture in this room came from Pearce's, and I tell everyone how happy I have been with the quality, prices, service, and excellent delivery. I have been dealing with Pearce's for about 25 years, choosing items on behalf of my former company employer, and later for my own home.&quot;

</div> </div>, object = component, showEditable = false, bodyRender = false, isConfigurator = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
74 ms 37 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(modules/examples/sampleModalWindow.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
69 ms 69 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onRequestStart_include.cfm
69 ms 9 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(content) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
68 ms 17 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getFeed() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
66 ms 9 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(targetParams) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
65 ms 4 ms 18 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | checkForInstanceOf(CFC: mura.servletEvent, mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
61 ms 31 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspThemeInclude) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
58 ms 10 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(ThemeIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
57 ms 10 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | next() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
54 ms 54 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(currentEventObject = CFC: mura.servletEvent, objectid = 00000000000000000000000000000000001, eventToAnnounce = onRenderStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
48 ms 24 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | read(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
47 ms 6 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc | validate(CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc
47 ms 16 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHref(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
46 ms 46 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/inc/footer.cfm
45 ms 8 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(themeIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
41 ms 41 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getContentVersion(contentHistID = 942DF1F7-155D-6942-02D12D1BD469D287, sourceIterator = CFC: mura.content.contentIterator, siteID = pearcesfurniture, contentBean = CFC: mura.content.contentBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
40 ms 1 ms 36 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(siteID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
37 ms 37 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/modules/v1/cta/model/handlers/handler.cfc | onRenderStart(mura = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, m = CFC: mura.MuraScope, event = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/modules/v1/cta/model/handlers/handler.cfc
37 ms 37 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getCrumbIterator() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
36 ms 3 ms 11 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc | getValue(ChangesetPreviewData) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc
35 ms 35 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getActiveContentByFilename(pearcesfurniture, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
34 ms 34 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc | readVersion(942DF1F7-155D-6942-02D12D1BD469D287, pearcesfurniture, false, CFC: mura.content.contentBean, CFC: mura.content.contentIterator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc
33 ms 17 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | renderEvent(onComponentDefaultBodyRender, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
33 ms 33 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | init(mura = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, event = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
31 ms 31 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | loadBy(name = carousel) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
30 ms 30 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc | read(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc
29 ms 7 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
29 ms 7 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentFeed) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
29 ms 29 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc | readActive(00000000000000000000000000000000001, pearcesfurniture, true, , ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc
28 ms 28 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/content_types/page/index.cfm
26 ms 13 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc | getCrumbList(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc
26 ms 26 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, D061E965-155D-6942-02F06791CBB1BF0F, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
25 ms 25 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | loadBy(contentID = 93109571-155D-6942-02F46FECAEE09D6F, siteID = pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
25 ms 25 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | loadBy(contentID = 93BC28E7-155D-6942-024F839DCE550B35, siteID = pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
25 ms 25 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 9272D7BA-155D-6942-0284E3582AC250CC, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
25 ms 25 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, C619377D-155D-6942-02B17A2E855AAD85, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
24 ms 12 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getBean(content) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
24 ms 24 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 3170A6D8-155D-6942-02F9B757B0D28049, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
23 ms 6 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | set([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
23 ms 23 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedDAO.cfc | readByName(carousel, pearcesfurniture, CFC: mura.content.feed.feedBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedDAO.cfc
22 ms 22 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | createHREF(filename = search-results) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
22 ms 22 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(attribute = body, type = htmlEditor) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
21 ms 21 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc | getKids(00000000000000000000000000000000000, pearcesfurniture, 00000000000000000000000000000000001, default, {ts '2019-07-21 13:26:22'}, 0, , 0, orderno, asc, , , , 0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc
21 ms 4 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | set([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
21 ms 21 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetPermissionsHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
21 ms 21 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(contentid = F93D7187-155D-6942-02FC18F9920BE42D, target = _self, targetparams = , stub = , siteid = pearcesfurniture, context = , indexfile = , complete = false, secure = false, type = Page, filename = promotions, querystring = , showmeta = 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
21 ms 21 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(contentid = F94003D1-155D-6942-0283541BE32EBA2E, target = _self, targetparams = , stub = , siteid = pearcesfurniture, context = , indexfile = , complete = false, secure = false, type = Page, filename = services, querystring = , showmeta = 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetPermissionsHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc | readActive(93109571-155D-6942-02F46FECAEE09D6F, pearcesfurniture, false, CFC: mura.content.contentBean, ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc | readActive(93BC28E7-155D-6942-024F839DCE550B35, pearcesfurniture, false, CFC: mura.content.contentBean, ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentDAO.cfc
20 ms 1 ms 18 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(IncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, , pearcesfurniture, 00000000000000000000000000000000001, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(contentid = F941BE1D-155D-6942-021DC63527705604, target = _self, targetparams = , stub = , siteid = pearcesfurniture, context = , indexfile = , complete = false, secure = false, type = Page, filename = contact-form, querystring = , showmeta = 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
20 ms 20 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 3187DFC7-155D-6942-02E91BF7FFC971B3, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
19 ms 19 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 926C404B-155D-6942-02CD39C98005240C, jpg, carousel, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
19 ms 6 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getTemplate() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
18 ms 18 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetLocaleHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
18 ms 18 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(version = 7.1, includeskin = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
18 ms 1 ms 15 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getWebPath(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
18 ms 18 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetLocaleHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
18 ms 18 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/bedding, pearcesfurniture, C4E15208-155D-6942-02ECF14F32EBE16E, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
18 ms 18 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/motion, pearcesfurniture, C61FCBEA-155D-6942-029D7A85DD17C16D, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
17 ms 6 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | getTemplate(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
17 ms 17 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc | getExtendedData(subType = Default, baseID = 34002954-155D-6942-02AD6D8FB10D714E, sourceIterator = , dataTable = tclassextenddata, siteID = pearcesfurniture, type = Component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc
17 ms 17 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc | getExtendedData(subType = Default, baseID = 91E64550-155D-6942-0272DD25D4A39C0A, sourceIterator = , dataTable = tclassextenddata, siteID = pearcesfurniture, type = Component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc
17 ms 17 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | loadBy(siteID = pearcesfurniture, name = carousel) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
17 ms 17 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc | read() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc
17 ms 17 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/bedroom, pearcesfurniture, 9270E65C-155D-6942-02F7975D470ACF65, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
16 ms 16 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | rbKey(search.search) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
16 ms 16 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | renderEvent(onBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
16 ms 16 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getCrumbList(contentID = 00000000000000000000000000000000001, path = 00000000000000000000000000000000001, setInheritance = false, sort = asc, siteID = pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
16 ms 16 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 9272D7BA-155D-6942-0284E3582AC250CC, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
16 ms 16 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, D061E965-155D-6942-02F06791CBB1BF0F, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
15 ms 15 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/scriptProtect_include.cfm
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | renderEvent(onPageBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | renderEvent(onPageDefaultBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
15 ms 0 ms 182 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
15 ms 3 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/processImgCfimage.cfc | getCustomImage(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/processImgCfimage.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | executeScripts(onGlobalMobileDetection) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | executeScripts(onGlobalRequestStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userDAO.cfc | read() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userDAO.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 3170A6D8-155D-6942-02F9B757B0D28049, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, C619377D-155D-6942-02B17A2E855AAD85, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
15 ms 15 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = renderEditableAttribute) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
14 ms 14 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/applicationSettings.cfm
14 ms 1 ms 16 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
14 ms 7 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(site) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getCrumbArray(setInheritance = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | renderEditableAttribute(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc | init(subType = Default, configBean = CFC: mura.configBean, baseID = 34002954-155D-6942-02AD6D8FB10D714E, sourceIterator = , dataTable = tclassextenddata, siteID = pearcesfurniture, type = Component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc | init(subType = Default, configBean = CFC: mura.configBean, baseID = 91E64550-155D-6942-0272DD25D4A39C0A, sourceIterator = , dataTable = tclassextenddata, siteID = pearcesfurniture, type = Component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | renderEvent(onDisplayRender, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | getValue(ChangesetPreviewData) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/dining-room, pearcesfurniture, 926A01F9-155D-6942-025712C26DF75633, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/kids-room, pearcesfurniture, 92658769-155D-6942-028495A40F5DD734, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(contentid = 901662A6-155D-6942-02E4B21B20EDE246, target = _self, targetparams = , stub = , siteid = pearcesfurniture, context = , indexfile = , complete = false, secure = false, type = Folder, filename = furniture, querystring = , showmeta = 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
14 ms 14 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(contentid = F945E9B5-155D-6942-02119AD8304874A1, target = _self, targetparams = , stub = , siteid = pearcesfurniture, context = , indexfile = , complete = false, secure = false, type = Page, filename = location, querystring = , showmeta = 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
13 ms 13 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getBean(feed) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
13 ms 7 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(isRemote) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
13 ms 13 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(onSiteRequestStart, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
13 ms 13 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getTranslator(standardHTML) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
13 ms 2 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | checkForInstanceOf(CFC: mura.MuraScope, mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
13 ms 13 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREF(Page, furniture/living-room, pearcesfurniture, 926DA9D1-155D-6942-02099AA2CB29D15E, _self, , , , , , false, 0, CFC: mura.content.contentNavBean, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
13 ms 13 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = outputMuraCSS) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
12 ms 4 ms 3 C:/inetpub/wwwroot/clients/mura7/core/mura/customtags/CacheOMatic.cfm
12 ms 2 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(type) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(<script src="//www.pearcesfurniture.com/core/modules/v1/cta/js/mura.displayobject.cta.min.js" defer="defer"></script>) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(assetPath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | getCrumbList(contentID = 00000000000000000000000000000000001, path = 00000000000000000000000000000000001, setInheritance = true, sort = asc, siteID = pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
12 ms 4 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc | init() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(onSiteRequestInit, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | executeScripts(onGlobalSessionStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | renderEvent(currentEventObject = CFC: mura.MuraScope, objectid = 00000000000000000000000000000000001, index = 0, eventToRender = onBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardHTMLTranslator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardForceSSLValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
12 ms 12 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 3187DFC7-155D-6942-02E91BF7FFC971B3, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
12 ms 6 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getDisplayObject(component) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
12 ms 6 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | hasDisplayObject(component) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardForceSSLValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
11 ms 1 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getBean(imageSize) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | previous() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc | getExtendedData(subType = Default, baseID = D7B29B31-155D-6942-02D9D0F9F6EC4F70, sourceIterator = , dataTable = tclassextenddatauseractivity, siteID = , type = 2) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | renderEvent(currentEventObject = CFC: mura.MuraScope, objectid = 00000000000000000000000000000000001, index = 0, eventToRender = onPageBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | renderEvent(currentEventObject = CFC: mura.MuraScope, objectid = 00000000000000000000000000000000001, index = 0, eventToRender = onPageDefaultBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
11 ms 11 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | createHREFForImage(pearcesfurniture, 926C404B-155D-6942-02CD39C98005240C, jpg, undefined, true, false, , , false, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
10 ms 10 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/inc/breadcrumb.cfm
10 ms 10 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(class = ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
10 ms 10 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(LoginURL) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
10 ms 10 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc | scan(objectname = cgi, ipAddress = 35.171.183.163, object = [complex value], useWordFilter = true, fixValues = false, useTagFilter = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc
10 ms 2 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | allowLink(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
10 ms 10 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(currentEventObject = CFC: mura.servletEvent, objectid = 00000000000000000000000000000000001, eventToAnnounce = onRenderEnd) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
10 ms 0 ms 72 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
9 ms 3 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | checkForInstanceOf(CFC: mura.event, mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
9 ms 9 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | setSessionCookies() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
8 ms 8 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onRequestEnd_include.cfm
8 ms 8 ms 1 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/templates/inc/html_foot.cfm
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/Application.cfc | onRequestEnd(/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/Application.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(<div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/universal.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/riverside.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/vaughan-bassett-furniture(1).png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/SignatureDesign_black_Logo.jpg" style="width:100%" /></div> <hr />) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(<div class="lightbox"> <h3 style="text-align: center;"><strong>What Our Customers Have to Say:</strong></h3> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Robinson</h4> <h5 style="text-align: center;">Atlanta / Townsend, GA</h5>

When we decided to build a second home in McIntosh County, we asked around as to where to shop for furniture.&quot; We were directed to Odum, GA to Pearces. We were&nbsp;very pleased with the store and with our sales person, Pam. Delivery&nbsp;- they called ahead and were right on target. I highly recommend Pearces Furniture!.&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hathaway</h4> <h5 style="text-align: center;">Richmond Hill, GA</h5>

&quot;We have&nbsp;been shopping at Pearces a&nbsp;<u>long time.</u>&nbsp;My husband grew up in that&nbsp;area and knows&nbsp;the Pearce family. We have been satisfied&nbsp;with everything we have ever purchased there.&nbsp;They're on&nbsp;time and pleasant with delivery.&nbsp;I have had special orders which always worked great - if I was ever looking for something and didn't see it, they brought out the books and helped me find it and ordered it for me (providing it was available, of course).&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Pollard</h4> <h5 style="text-align: center;">Odum, GA</h5>

&quot;We have purchased furniture from Pearces on multiple occasions, the most recent being while we remodeled our home. They were&nbsp;<u>very</u>&nbsp;accomodating and worked with us on our time frame. We will definitely go back. 'Against the competition?......They are definitely on top!&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hicks</h4> <h5 style="text-align: center;">Keystone Heights, FL</h5>

&quot;Most all of the furniture in this room came from Pearce's, and I tell everyone how happy I have been with the quality, prices, service, and excellent delivery. I have been dealing with Pearce's for about 25 years, choosing items on behalf of my former company employer, and later for my own home.&quot;

</div> </div>) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(JSDateKeyObjInc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(feed) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(user) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc | init(subType = Default, configBean = CFC: mura.configBean, baseID = D7B29B31-155D-6942-02D9D0F9F6EC4F70, sourceIterator = , dataTable = tclassextenddatauseractivity, siteID = , type = 2) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/permission.cfc | setRestriction([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/permission.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(onSiteRequestEnd, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc | resetSessionLocale() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardWrongFilenameValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
8 ms 8 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | renderHTMLQueue(Foot) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
7 ms 7 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardWrongFilenameValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
7 ms 7 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | onMissingMethod(Home) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
7 ms 7 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(reCAPTCHALanguage) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
7 ms 7 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | siteConfig(templateIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
7 ms 0 ms 94 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(settingsManager) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
7 ms 7 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | announceEvent(onGlobalRequestEnd, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
7 ms 0 ms 251 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
6 ms 6 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(imageSize) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
6 ms 6 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc | getObjects(2, 942DF1F7-155D-6942-02D12D1BD469D287, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc
6 ms 3 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentUtility.cfc | formatFilename(carousel) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentUtility.cfc
6 ms 6 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedGateway.cfc | getFeeds(pearcesfurniture, Local, true, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedGateway.cfc
6 ms 6 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc | getFeeds(pearcesfurniture, Local, true, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc
6 ms 2 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc | getKeyValue(en_US, sitemanager.content.published) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc
6 ms 0 ms 179 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
6 ms 2 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | datetimeToTimespanInterval({ts '2019-07-21 13:26:22'}, 0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
6 ms 6 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetIsOnDisplayHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetIsOnDisplayHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
5 ms 3 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(body) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
5 ms 0 ms 60 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc | getCastString(random, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc | getKey(search.search) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getCorePath(complete = true, useProtocol = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getLocalHandler() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
5 ms 2 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(assetPath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
5 ms 0 ms 36 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(themeAssetPath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardWrongDomainValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
5 ms 5 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = addToHTMLFootQueue) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
4 ms 4 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardWrongDomainValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
4 ms 1 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(r) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
4 ms 4 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | addToHTMLFootQueue(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
4 ms 2 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc | getKeyValue(en_US, search.search, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc
4 ms 2 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getJavaLocale() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
4 ms 2 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isPathLegal(/muraWRM/sites/pearcesfurniture/includes/themes/MuraBootstrap4/modules/examples/sampleModalWindow.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
4 ms 4 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = dspCrumbListLinks) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(HTMLTitle) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(contentID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(metaDesc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
3 ms 1 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | globalConfig(version) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/cluster/clusterManager.cfc | runCommands() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/cluster/clusterManager.cfc
3 ms 0 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | addToHTMLHeadQueue(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | dspCrumblistLinks(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | getTopId(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/jsonSerializer.cfc | serialize([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/jsonSerializer.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc | init(CFC: mura.Translator.standardHTMLTranslator, standardHTMLTranslator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventWrapper.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/queryParam.cfc | init(criteria = , datatype = varchar, field = , condition = Equals, relationship = and) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/queryParam.cfc
3 ms 1 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getSite() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
3 ms 0 ms 159 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(contentRenderer) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | init() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getCorePath(complete = false, useProtocol = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
3 ms 1 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(LoginURL) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userUtility.cfc | returnLoginCheck(CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userUtility.cfc
3 ms 2 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | datetimeToTimespanInterval({ts '2019-07-21 13:26:23'}, 0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standard404Validator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardRequireLoginValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetAdTrackingHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | setCookie(value = D7B286D6-155D-6942-023F61DFD5BD881E, name = MXP_TRACKINGID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getShowToolbar() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
3 ms 1 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodName = getTopID) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
3 ms 3 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodName = hasFETools) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/modules/v1/login/model/handlers/authHandler.cfc | onGlobalRequestStart(mura = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, m = CFC: mura.MuraScope, event = CFC: mura.event) ] from C:/inetpub/wwwroot/clients/mura7/core/modules/v1/login/model/handlers/authHandler.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standard404Validator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardRequireLoginValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetAdTrackingHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(contenthistid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(contentid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(credits) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(depth) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(menuTitle) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(metaKeywords) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(parentid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(searchExclude) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | content(subtype) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(currentfilename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | getBean(feedManager) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | globalConfig(context) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | renderCSRFTokens(format = form, context = search) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
2 ms 0 ms 61 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getAssetPath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
2 ms 0 ms 36 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
2 ms 0 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
2 ms 0 ms 30 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
2 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
2 ms 1 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | onMissingMethod(tcontent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardForceSSL) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
2 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getIncludePath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardDoActionsHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardEnableLockdownValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardForceSSLHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardSetCommentPermissionsHandler, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardTrackSessionValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | setCookie(value = false, name = mobileFormat) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/bedding) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, promotions) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = createCSSHook) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
2 ms 2 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | postMergeInit() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onSessionStart_include.cfm
1 ms 0 ms 105 C:/inetpub/wwwroot/clients/mura7/core/mura/backport/esapiencode.cfm
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/Application.cfc | onSessionStart() ] from C:/inetpub/wwwroot/clients/mura7/Application.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardDoActionsHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardEnableLockdownValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardForceSSLHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardSetCommentPermissionsHandler(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardTrackSessionValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(amp) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(keywords) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(muraMobileRequest) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(nocache) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event(returnID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | globalConfig(corepath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc | isBlocked(35.171.183.163) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc | scan(objectname = cookie, ipAddress = 35.171.183.163, object = [complex value], useWordFilter = true, fixValues = false, useTagFilter = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc | scan(objectname = url, ipAddress = 35.171.183.163, object = [complex value], useWordFilter = true, useTagFilter = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc
1 ms 0 ms 52 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getContext() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(blockFactor = 20, cachedWithin = 0, name = rsFeed) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsContent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsModulePerm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getSiteAssetPath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 0 ms 20 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getSiteIncludePath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 0 ms 21 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getStub() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(contentid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
1 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(type) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod(1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
1 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIntervalManager.cfc | apply(query = [complex value], from = {ts '2019-07-21 13:25:00'}, to = {ts '2020-07-21 13:25:00'}, current = {ts '2019-07-21 13:25:00'}) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIntervalManager.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIntervalManager.cfc | applyByMenuTypeAndDate(query = [complex value], menuDate = {ts '2019-07-21 13:25:00'}, menuType = default) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIntervalManager.cfc
1 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | hasNext() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
1 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(fileID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
1 ms 0 ms 38 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(siteID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
1 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | set([complex value], CFC: mura.content.contentIterator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | createCSSHook(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
1 ms 0 ms 10 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getOrderBy() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetContentHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc | init(en_US) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardDoActions) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardDoResponse) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetAdTracking) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetCommentPermissions) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetContent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetIsOnDisplay) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetLocale) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetPermissions) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardTranslation) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standard404) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardEnableLockdown) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardForceSSL) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardRequireLogin) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardTrackSession) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardWrongDomain) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardWrongFilename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 0 ms 36 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 0 ms 46 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(siteID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
1 ms 0 ms 20 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getContentRenderer() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 0 ms 18 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(ThemeIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | hasDisplayObject(component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupContentTypeFilePath(component/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupContentTypeFilePath(component_default/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupContentTypeFilePath(page_default/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getList(sortBy = orderno) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
1 ms 0 ms 94 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc | renderCSRFTokens(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | datetimeToTimespanInterval({ts '2019-07-21 13:26:22'}, 0.00347222222222) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | getRequestHost() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | invokeMethod(methodName = standardMobileValidator, args = [complex value], component = CFC: mura.Handler.standardEventsHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onGlobalSessionStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onSiteRequestEnd) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, contact-form) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/bedroom) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/dining-room) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/kids-room) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/living-room) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, furniture/motion) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, location) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, search-results) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getURLStem(pearcesfurniture, services) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 0 ms 15 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | hasMuraScope() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTTHUMBCLASS, img-thumbnail) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CONTENTLISTITEMIMAGELINKCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEEXTATTRIBUTEDOWNLOADCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMFILECLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = setDynamicContent) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | setDynamicContent() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
1 ms 1 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | setDynamicContent(<h1>Welcome</h1>

<em><strong>You Can Pay More... but at Pearces, You Don't Have To!</strong></em>

We hope your like our&nbsp;new website. The enhanced technology you see here will allow us to better serve&nbsp;you. We intend to use this new technology to further enhance the shopping experience at Pearce's now and in the future with even more conveniences. We heartily encourage your input. We need your feed back to&nbsp;improve. Please use this website to shop Pearce's at YOUR convenience no matter what the time of day or the price of gas.&nbsp;

Here is what you can currently do:

You can use this site to get your interior design questions answered by our&nbsp;specialist that have over 250 years combined experience in the home furnishing industry. Just email your questions to us from the <strong>"CONTACT US"</strong> link, or if it is during business hours, just give us a call.

You can preview <strong>"PEARCE'S SPECIALS"</strong> before they are advertised anywhere else. We use our&nbsp;volume to encourage the best possible price from our&nbsp;vendors, and pass these saving on to you. From time to time, we have special purchases that&nbsp;are extremely discounted, even for us. Now, you can see these specials in some cases before they even make it to our showrooms. Please remember, because of competition agreements with our&nbsp;premium&nbsp;vendors, we can not usually advertise price.

You can read what our&nbsp;customers have to say by reading <strong>"WHAT OUR CUSTOMERS HAVE TO SAY."</strong>

These are a few of the things that have changed at Pearce's. The things that have not changed are our commitment to quality and service. By continuing to use our&nbsp;volume to deliver you the best possible, pricing we are still able to offer <strong>"FREE DELIVERY"</strong> to our&nbsp;customers within a 100 mile radius.

<hr>) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/config/cfapplication.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onApplicationStart_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onError_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onMissingTemplate_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onRequestEnd_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onRequestStart_scriptProtect_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onSessionEnd_method.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/core/appcfc/onSessionStart_method.cfm
0 ms 0 ms 2 C:/inetpub/wwwroot/clients/mura7/core/modules/v1/object/meta.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/plugins/cfapplication.cfm
0 ms 0 ms 1 C:/inetpub/wwwroot/clients/mura7/plugins/mappings.cfm
0 ms 0 ms 2 C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/modules/examples/sampleModalWindow.cfm
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/modules/v1/cta/model/handlers/handler.cfc | getValue(_objectName) ] from C:/inetpub/wwwroot/clients/mura7/core/modules/v1/cta/model/handlers/handler.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/modules/v1/login/model/handlers/authHandler.cfc | getValue(_objectName) ] from C:/inetpub/wwwroot/clients/mura7/core/modules/v1/login/model/handlers/authHandler.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc | standardMobileValidator(MURA = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, M = CFC: mura.MuraScope, EVENT = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Handler/standardEventsHandler.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | currentUser() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | event() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | globalConfig(corePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | hasParent() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | setEvent(CFC: mura.event) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc | setEvent(CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/MuraScope.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc | scan(objectname = form, ipAddress = 35.171.183.163, object = [complex value], useWordFilter = true, useTagFilter = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Portcullis.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/Translator/standardHTMLTranslator.cfc | init() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/Translator/standardHTMLTranslator.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | containsBean(contentFeed) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | containsBean(contentManager) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(configBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentGateway) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentRenderer) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentRendererUtility) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(contentUtility) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(feedManager) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(fileManager) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(userUtility) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc | getBean(utility) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/bean/beanFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/client/api/feed/v1/apiUtility.cfc | getEndpoint() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/client/api/feed/v1/apiUtility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/client/api/json/v1/apiUtility.cfc | getSerializer() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/client/api/json/v1/apiUtility.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getAdminDomain() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getAdminSSL() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getAllValues() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getClassExtensionManager() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getCompiler() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 33 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getDBType() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getDbType() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getDefaultLocale() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getEnableMuraTag() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getFileDir() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getFileStore() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getIndexFile() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getIndexFileInURLs() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getMode() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getPluginDir() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyDatasource() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyDbPassword() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyDbUsername() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(cachedwithin = 1.15740740741E-005, name = rs) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rs) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsCommands) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsCrumbData) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsExtended) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsKids) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsObjects) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsPage) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getReadOnlyQRYAttrs(name = rsUser) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getScriptProtect() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getServerPort() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getSiteDir() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getSiteIDInURLs() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getSiteMap() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getStrictExtendedData() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(compiler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = HSTSMaxAge, defaultValue = 1200) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = JavaEnabled, defaultValue = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = alwaysUseLocalRenderer, defaultValue = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = cacheImageFileLookups, defaultValue = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = forceDirectoryStructure, defaultValue = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(property = saveEmptyExtendedValues, default = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(remoteIPHeader) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getValue(useLegacySessions) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getVersion() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | getWebRoot() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | invokeMethod(methodName = getcontext) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | invokeMethod(methodName = getcorePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | invokeMethod(methodName = getcorepath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc | invokeMethod(methodName = getversion) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/configBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | exists() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getAllValues(autocomplete = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getContentID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getIsHome() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getObjectParams() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(HTMLTitle) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(body) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(contentID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(contenthistid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(credits) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(depth) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(menuTitle) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(metaDesc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(metaKeywords) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(parentid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(searchExclude) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getValue(subtype) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getcontentID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getcontenthistid() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | getcontentid() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | hasImage(usePlaceholder = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod(0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod(34002954-155D-6942-02AD6D8FB10D714E) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod(91E64550-155D-6942-0272DD25D4A39C0A) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | onMissingMethod(942DF1F7-155D-6942-02D12D1BD469D287) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setAllValues([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setConfigBean(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setContentManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setSettingsManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setValue(siteid, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | setValue(sourceIterator, CFC: mura.content.contentIterator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 8 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentGatewayAdobe.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | end() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | getNextN() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | getPageIDList() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | getPageIndex() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | getPageQuery(page1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | hasPrevious() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | reset() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | setArray([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | setPageQuery(page1, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | setQuery([complex value], 20) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentIterator.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc | validate() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentManager.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(contentID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(fileEXT) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(filename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(target) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | getValue(type) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | setContentManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | setSettingsManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 13 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentNavBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRenderer.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentRendererUtility.cfc
0 ms 0 ms 16 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc | getURLStem(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentServer.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentUtility.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/contentUtility.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getAdvancedParams() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getContentPoolID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getDistinct() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getFields() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | getJoins() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 10 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | isAggregateQuery() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | onMissingMethod(0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | onMissingMethod(pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setAdvancedParams([complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setCategoryID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setConfigBean(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setEntityName(content) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setFeedManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setValue(siteid, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | setcontentID(901662A6-155D-6942-02E4B21B20EDE246) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/feed/feedManager.cfc
0 ms 0 ms 12 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/fileManager.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/content/file/fileManager.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc | getAllValues() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc | getValue(localHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc | getValue(muraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc
0 ms 0 ms 14 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc | getValue(siteID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/event.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc | getAllExtendSetData() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc | getAttribute(ChangesetPreviewData, false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendData.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc | getDefinitionsQuery() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/extend/extendManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | getGlobalListener(standardHTMLTranslator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | getSiteListener(pearcesfurniture, standardHTMLTranslator) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc | getStandardEventFactory(pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standard404Validator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardDoActionsHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardDoResponseHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardEnableLockdownValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardForceSSLHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardForceSSLValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardMobileValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardRequireLoginValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetAdTrackingHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetCommentPermissionsHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetContentRendererHandler, ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetIsOnDisplayHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetLocaleHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardSetPermissionsHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardTrackSessionValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardTranslationHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardWrongDomainValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc | get(standardWrongFilenameValidator, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/plugin/pluginStandardEventFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/queryParam.cfc | getIsValid() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/queryParam.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc | getKeyValue(search.search, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc | getKeyValue(sitemanager.content.published, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc | getUtils() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundle.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc | CF2Java(Server) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/resourceBundleFactory.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc | getJSDateKey() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc | getJSDateKeyFormat() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/resourceBundle/utils.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getContentRenderer() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getHandler(standardSetContentRenderer) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getThemeRenderer() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValidator(standardMobile) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(__MuraResponse__) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(amp) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(categoryID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 102 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(contentBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(crumbData) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(crumbdata) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(currentFilename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(currentFilenameAdjusted) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(currentfilename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(day) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(display) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(doaction) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(filterby) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(isOnDisplay) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(keywords) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(linkServID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 24 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(localHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(month) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraChangesetPreviewToolbar) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraForceFilename) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraMobileRequest) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraSiteIDRedirect) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(muraValidateDomain) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(nocache) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(pageNum) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(previewID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(property = HTMLFootQueue, defaultValue = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(property = HTMLHeadQueue, defaultValue = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 16 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(r) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(relatedID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(returnID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(startRow) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(startrow) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(trackSession) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | getValue(year) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(BodyRenderArgs, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(HTMLFootQueue, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(HTMLHeadQueue, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(__MuraResponse__, <!DOCTYPE html> <html lang="en"> <head> <meta charset="utf-8"> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <meta name="viewport" content="width=device-width, initial-scale=1.0"> <meta name="description" content=""> <meta name="keywords" content=""> <meta name="generator" content="Mura CMS 7.1.370"> <title>Home - Pearces Furniture</title> <link rel="stylesheet" href="/core/modules/v1/core_assets/css/mura.7.1.min.css?v=7.1.370"><link rel="stylesheet" href="/core/modules/v1/core_assets/css/mura.7.1.skin.css?v=7.1.370"> <link rel="stylesheet" href="/sites/pearcesfurniture/includes/themes/MuraBootstrap4/css/bootstrap.css"> <link rel="stylesheet" href="/sites/pearcesfurniture/includes/themes/MuraBootstrap4/assets/font-awesome/css/font-awesome.css"> <link rel="stylesheet" href="/sites/pearcesfurniture/includes/themes/MuraBootstrap4/css/site.css"> <script src="/sites/pearcesfurniture/includes/themes/MuraBootstrap4/js/libraries/jquery-3.3.1.min.js"></script> <link rel="shortcut icon" href="/core/modules/v1/core_assets/images/favicon.ico"> <script type="text/javascript" src="/core/modules/v1/core_assets/js/mura.min.js?v=7.1.370" defer="defer"></script> <script> (function(root,config){root.queuedMuraCmds=[],root.queuedMuraPreInitCmds=[],root.deferMuraInit=function(){void 0!==root.Mura&&"function"==typeof root.Mura.init?root.Mura.init(config):("function"!=typeof root.Mura&&(root.mura=root.m=root.Mura=function(o){root.queuedMuraCmds.push(o)},root.Mura.preInit=function(o){root.queuedMuraPreInitCmds.push(o)}),setTimeout(root.deferMuraInit))},root.deferMuraInit();} )(this,{ loginURL:"?display=login", siteid:"pearcesfurniture", contentid:"00000000000000000000000000000000001", contenthistid:"942DF1F7-155D-6942-02D12D1BD469D287", parentid:"00000000000000000000000000000000END", context:"", nocache:0, assetpath:"/sites/pearcesfurniture", corepath:"/core", themepath:"/sites/pearcesfurniture/includes/themes/MuraBootstrap4", reCAPTCHALanguage:"en", preloaderMarkup: "/x3Ci/x20class/x3D/x22mura/x2Dpreloader/x20fa/x20fa/x2Drefresh/x20fa/x2Dspin/x22/x3E/x3C/x2Fi/x3E", mobileformat: false, windowdocumentdomain: "", layoutmanager:true, type:"Page", subtype:"Default", queueObjects: true, rb:{"formcheckboxlabelclass":"form-check-label","formgeneralcontrolclass":"form-control","formrequiredlabel":"Required","formcheckboxclass":"form-check-input","formradiolabelclass":"form-check-label","formbuttoncancelclass":"form-cancel btn btn-danger","formwrapperbodyclass":"","formbuttonsubmitclass":"form-submit btn-primary","formtextareaclass":"form-control","formfileclass":"form-control","formbuttoninnerclass":"","formbuttonsubmitwaitlabel":"Please Wait...","formbuttonwrapperclass":"btn-group","formrequiredwrapperclass":"","formbuttonnextlclass":"form-nav","formbuttonclass":"btn btn-primary","formbuttonnextlabel":"Next","formradioclass":"form-check-input","formbuttomsubmitclass":"form-submit btn btn-primary","formfieldlabelclass":"control-label","formbuttonbacklabel":"Back","formwrapperclass":"","formerrorwrapperclass":"","formradiowrapperclass":"form-check","formbuttonbackclass":"form-nav","formresponsewrapperclass":"","formselectclass":"form-control","generalwrapperbodyclass":"","formcheckboxwrapperclass":"form-check","generalwrapperclass":"","forminputclass":"form-control","formfieldwrapperclass":"form-group","formbuttonsubmitlabel":"Submit","formbuttoncancellabel":"Cancel"}, dtExample:"11/10/2024", dtCh:"/", dtFormat:[0,1,2], dtLocale:"en-US" }); </script></head> <body id="homepage" class="depth-0 home"> <header> <nav class="navbar navbar-expand-lg bg-light navbar-light navbar-static-top py-4"> <div class="container"> <a class="navbar-brand" href="/"><img src="/sites/pearcesfurniture/assets/Image/pearceslogo2.png"></a> <button class="navbar-toggler" type="button" data-toggle="collapse" data-target="#siteNavbar" aria-controls="siteNavbar" aria-expanded="false" aria-label="Toggle navigation"> <span class="navbar-toggler-icon"></span> </button> <div class="navbar-collapse collapse" id="siteNavbar"> <ul id="navPrimary" class="navbar-nav mr-auto"> <li class="first nav-item"><a href="/" class="nav-link active">Home</a> <li class="nav-item"><a href="/index.cfm/furniture/" class="nav-link">Furniture</a> <li class="nav-item"><a href="/index.cfm/location/" class="nav-link">Location</a> <li class="nav-item"><a href="/index.cfm/promotions/" class="nav-link">Promotions</a> <li class="nav-item"><a href="/index.cfm/services/" class="nav-link">Services</a> <li class="last nav-item"><a href="/index.cfm/contact-form/" class="nav-link">Contact Form</a> <script> Mura(function(){ ["/"].forEach( function(value){ navItem=Mura("#navPrimary [href='" + value + "']"); if(navItem.length){ var navItem=Mura("#navPrimary [href='" + value + "']").closest("li"); if(navItem.length){ navItem.addClass("active"); } } } ); }) </script> <form method="post" id="searchForm" class="form-inline" role="search" action="/index.cfm/search-results/"> <div class="input-group"> <input type="text" name="Keywords" id="navKeywords" class="form-control" value="" placeholder="Search" aria-label="Search"> <span class="input-group-btn"> <button type="submit" class="btn btn-secondary"> <i class="fa fa-search" aria-hidden="true"> <span class="sr-only">Search</span> </button> </span> </div> <input type="hidden" name="display" value="search"> <input type="hidden" name="newSearch" value="true"> <input type="hidden" name="noCache" value="1"> <input type="hidden" name="csrf_token" value="0133A33B5B81B13821296A0211F2A18F" /><input type="hidden" name="csrf_token_expires" value="190721162623563" /> </form> </div> </div> </nav> </header> <div id="myCarousel" class="carousel slide" data-ride="carousel" data-interval="5000"> <div class="carousel-inner"> <div class="carousel-item active"> <img src="/sites/pearcesfurniture/cache/file/D061E965-155D-6942-02F06791CBB1BF0F_carousel.jpg" alt="Motion" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/motion/">Motion</a></h3> </div> </div> </div> <div class="carousel-item"> <img src="/sites/pearcesfurniture/cache/file/C619377D-155D-6942-02B17A2E855AAD85_carousel.jpg" alt="Bedding" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/bedding/">Bedding</a></h3> </div> </div> </div> <div class="carousel-item"> <img src="/sites/pearcesfurniture/cache/file/9272D7BA-155D-6942-0284E3582AC250CC_carousel.jpg" alt="Bedroom" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/bedroom/">Bedroom</a></h3> </div> </div> </div> <div class="carousel-item"> <img src="/sites/pearcesfurniture/cache/file/3170A6D8-155D-6942-02F9B757B0D28049_carousel.jpg" alt="Living Room" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/living-room/">Living Room</a></h3> </div> </div> </div> <div class="carousel-item"> <img src="/sites/pearcesfurniture/cache/file/3187DFC7-155D-6942-02E91BF7FFC971B3_carousel.jpg" alt="Kid's Room" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/kids-room/">Kid's Room</a></h3> </div> </div> </div> <div class="carousel-item"> <img src="/sites/pearcesfurniture/cache/file/926C404B-155D-6942-02CD39C98005240C_carousel.jpg" alt="Dining Room" class="d-block w-100"> <div class="carousel-caption d-none d-md-block p-md-5"> <div class="container"> <h3><a href="/index.cfm/furniture/dining-room/">Dining Room</a></h3> </div> </div> </div> </div> <a class="carousel-control-prev" href="#myCarousel" role="button" data-slide="prev"> <span class="carousel-control-prev-icon" aria-hidden="true"></span> <span class="sr-only">Previous</span> </a> <a class="carousel-control-next" href="#myCarousel" role="button" data-slide="next"> <span class="carousel-control-next-icon" aria-hidden="true"></span> <span class="sr-only">Next</span> </a> <script>jQuery(document).ready(function($){$('#myCarousel').carousel({interval:5000});});</script> </div> <div class="template py-5"> <div class="container"> <nav class="mb-5"></nav> <div class="row"> <section class="col-md-12 col-lg-9 col-xl-9 content"> <div class="mura-body"> <div class="mura-region mura-region-loose"> <div class="mura-region-local"><h1>Welcome</h1>

<em><strong>You Can Pay More... but at Pearces, You Don't Have To!</strong></em>

We hope your like our&nbsp;new website. The enhanced technology you see here will allow us to better serve&nbsp;you. We intend to use this new technology to further enhance the shopping experience at Pearce's now and in the future with even more conveniences. We heartily encourage your input. We need your feed back to&nbsp;improve. Please use this website to shop Pearce's at YOUR convenience no matter what the time of day or the price of gas.&nbsp;

Here is what you can currently do:

You can use this site to get your interior design questions answered by our&nbsp;specialist that have over 250 years combined experience in the home furnishing industry. Just email your questions to us from the <strong>"CONTACT US"</strong> link, or if it is during business hours, just give us a call.

You can preview <strong>"PEARCE'S SPECIALS"</strong> before they are advertised anywhere else. We use our&nbsp;volume to encourage the best possible price from our&nbsp;vendors, and pass these saving on to you. From time to time, we have special purchases that&nbsp;are extremely discounted, even for us. Now, you can see these specials in some cases before they even make it to our showrooms. Please remember, because of competition agreements with our&nbsp;premium&nbsp;vendors, we can not usually advertise price.

You can read what our&nbsp;customers have to say by reading <strong>"WHAT OUR CUSTOMERS HAVE TO SAY."</strong>

These are a few of the things that have changed at Pearce's. The things that have not changed are our commitment to quality and service. By continuing to use our&nbsp;volume to deliver you the best possible, pricing we are still able to offer <strong>"FREE DELIVERY"</strong> to our&nbsp;customers within a 100 mile radius.

<hr></div> </div> </div> <div class="mura-region"><div class="mura-region-local"><div class="mura-object" data-object="component" data-objectid="93BC28E7-155D-6942-024F839DCE550B35" data-instanceid="D7B30B25-155D-6942-0225C6485684866C" style="" data-objecticonclass="mi-clone" data-objectname="" data-async="false" data-render="server" data-cssid="" data-class="" data-contentcssid="" data-inited="YES" data-contentcssstyles="&#x7b;&#x7d;" data-metacssstyles="&#x7b;&#x7d;" data-contentcssclass="" data-cssclass="" data-cssstyles="&#x7b;&#x7d;"><div id="" class="mura-object-content" style=""><div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/universal.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/riverside.png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/vaughan-bassett-furniture(1).png" style="width:100%" /></div> <div class="collection"><img alt="" src="/sites/pearcesfurniture/assets/Image/SignatureDesign_black_Logo.jpg" style="width:100%" /></div> <hr /></div></div><div class="mura-object" data-object="component" data-objectid="93109571-155D-6942-02F46FECAEE09D6F" data-instanceid="D7B31AAC-155D-6942-02294BC8F89DAC06" style="" data-objecticonclass="mi-clone" data-objectname="" data-async="false" data-render="server" data-cssid="" data-class="" data-contentcssid="" data-inited="YES" data-contentcssstyles="&#x7b;&#x7d;" data-metacssstyles="&#x7b;&#x7d;" data-contentcssclass="" data-cssclass="" data-cssstyles="&#x7b;&#x7d;"><div id="" class="mura-object-content" style=""><div class="lightbox"> <h3 style="text-align: center;"><strong>What Our Customers Have to Say:</strong></h3> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Robinson</h4> <h5 style="text-align: center;">Atlanta / Townsend, GA</h5>

When we decided to build a second home in McIntosh County, we asked around as to where to shop for furniture.&quot; We were directed to Odum, GA to Pearces. We were&nbsp;very pleased with the store and with our sales person, Pam. Delivery&nbsp;- they called ahead and were right on target. I highly recommend Pearces Furniture!.&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hathaway</h4> <h5 style="text-align: center;">Richmond Hill, GA</h5>

&quot;We have&nbsp;been shopping at Pearces a&nbsp;<u>long time.</u>&nbsp;My husband grew up in that&nbsp;area and knows&nbsp;the Pearce family. We have been satisfied&nbsp;with everything we have ever purchased there.&nbsp;They're on&nbsp;time and pleasant with delivery.&nbsp;I have had special orders which always worked great - if I was ever looking for something and didn't see it, they brought out the books and helped me find it and ordered it for me (providing it was available, of course).&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Pollard</h4> <h5 style="text-align: center;">Odum, GA</h5>

&quot;We have purchased furniture from Pearces on multiple occasions, the most recent being while we remodeled our home. They were&nbsp;<u>very</u>&nbsp;accomodating and worked with us on our time frame. We will definitely go back. 'Against the competition?......They are definitely on top!&quot;

</div> <div class="col-lg-6 col-md-6 col-sm-12 col-xs-12 bluebox"> <h4 style="text-align: center;">Mrs. Hicks</h4> <h5 style="text-align: center;">Keystone Heights, FL</h5>

&quot;Most all of the furniture in this room came from Pearce's, and I tell everyone how happy I have been with the quality, prices, service, and excellent delivery. I have been dealing with Pearce's for about 25 years, choosing items on behalf of my former company employer, and later for my own home.&quot;

</div> </div></div></div></div></div> </section> <aside class="col-md-12 col-lg-3 col-xl-3 sidebar"> <h4 style="text-align: center;">Our Vendors</h4>
  • <a href="http://www.universalfurniture.com/" target="_blank">Universal</a>

  • <a href="http://www.vaughan-bassett.com/" target="_blank" title="Broyhill">Vaughan-Bassett</a>

  • <a href="http://www.troutmanchairs.com/products.html" target="_blank" title="Troutman">Troutman</a>

  • <a href="http://www.teioak.com/" target="_blank">Tennessee Enterprises</a>

  • <a href="http://www.templefurniture.com/" target="_blank" title="Temple Furniture">Temple Furniture</a>

  • <a href="https://www.southerlandsleep.com" target="_blank">Southerland Bedding</a>

  • <a href="http://www.serta.com/" target="_blank" title="Temple Furniture">Serta</a>

  • <a href="http://www.riverside-furniture.com/default.asp" target="_blank" title="Riverside Furniture">Riverside Furniture</a>

  • <a href="http://restonic.com/" target="_blank">Restonic Bedding</a>

  • <a href="http://www.pulaskifurniture.com/" target="_blank" title="Pulaski Furniture">Pulaski Furniture</a>

  • <a href="http://www.powellfurniture.com" target="_blank" title="Broyhill">Powell</a>

  • <a href="http://www.pennsylvaniahouse.com/" target="_blank">Pennsylvania House</a>

  • <a href="https://www.mylibertyfurniture.com/" target="_blank" title="Lane Furniture">Liberty Furniture</a>

  • <a href="http://www.lancerfurniture.com/" target="_blank">Lancer Furniture</a>

  • <a href="http://www.homestretchfurniture.com/" target="_blank" title="Lane Furniture">HomeStretch Furniture</a>

  • <a href="http://www.hinklechair.com/" target="_blank">Hinkle Chair Company</a>

  • <a href="http://www.cmfurniture.com" target="_blank">Emerald Craft by Craftmaster</a>

  • <a href="http://www.crownmark.com/" target="_blank">Crown Mark</a>

  • <a data-toggle="modal" href="#myModal">Chairs America</a>

  • <a href="http://www.carolinafurnitureworks.com/" target="_blank" title="Broyhill">Carolina Furniture</a>

  • <a href="http://www.besthf.com/besthf/Furniture/Home" target="_blank" title="Best Chairs">Best Home Furnishings</a>

  • <a href="http://www.ashleyfurniture.com/" target="_blank" title="Ashley Furniture">Ashley</a>

</aside> </div> </div> </div> <footer> <div class="py-5 bg-light"> <div class="container"> <div class="row"> <div class="col-lg-5 mb-4"> <div class="whitebox"> <h4>About</h4>

Pearce's Furniture is making your home as different as you are. We strive to find and work with manufacturers that allow custom choices. That is the reason our sales floor has merchandise that is not just like your neighbor's who bought from the cookie-cutter store.

We also value quality manufactures. We have always felt that we could not maintain our reputaion by selling merchandise we have to apologize for while trying to keep our prices as reasonable as possible. Remember, "You can spend more, but at PEARCES you don't have too."

</div> </div> <div class="col-lg-7 col-xl-4 mb-4"> <div class="whitebox"> <h4>Contact Info</h4> <ul class="list-unstyled"> <li class="mb-2"> <i class="fa fa-phone mr-1" aria-hidden="true"> <a href="tel:1-912-586-2271">912-586-2271</a> <li class="mb-2"> <i class="fa fa-envelope mr-1" aria-hidden="true"> <a href="mailto:information@pearcesfurniture.com">information@pearcesfurniture.com</a> <ul class="list-unstyled"> <li class="mb-2"> <i class="fa fa-plug mr-1" aria-hidden="true"> <a href="http://www.getmura.com">Powered by Web Electronics</a> </div> </div> <div class="col-lg-12 col-xl-3 mb-4"> <div class="whitebox">

<iframe frameborder="0" height="auto" marginheight="0" marginwidth="0" scrolling="no" src="http://maps.google.com/maps?f=q&amp;source=s_q&amp;hl=en&amp;geocode=&amp;q=116+S+Church+St,+Odum,+GA+31555&amp;sll=37.0625,-95.677068&amp;sspn=32.80241,56.25&amp;ie=UTF8&amp;ll=31.674202,-82.024441&amp;spn=0.008602,0.013733&amp;z=14&amp;iwloc=addr&amp;output=embed&amp;s=AARTsJqzFXZ735a1-kUXrafdbaxwwB7Mog" width="100%"></iframe><br /> <a href="http://maps.google.com/maps?f=q&amp;source=s_q&amp;hl=en&amp;geocode=&amp;q=116+S+Church+St,+Odum,+GA+31555&amp;sll=37.0625,-95.677068&amp;sspn=32.80241,56.25&amp;ie=UTF8&amp;ll=31.665655,-82.028668&amp;spn=0.008602,0.013733&amp;z=16&amp;iwloc=addr" target="_blank"><small>View Larger Map</small> </a>&amp; Directions from where you are!

</div> </div> </div> </div> </div> <div class="py-2 bg-secondary text-light"> <div class="container"> <p class="mb-0">&copy; Pearces Furniture 2019

</div> </div> </footer> <div id="myModal" class="modal fade"> <div class="modal-dialog"> <div class="modal-content"> <div class="modal-header"> <h5 class="modal-title">Chairs America</h5> <button type="button" class="close" data-dismiss="modal" aria-label="Close"> <span aria-hidden="true">&times;</span> </button> </div> <div class="modal-body">

Call us for information about Chairs America 912-586-2271 (they do not currently have a website)

</div> <div class="modal-footer"> <button class="btn btn-primary" data-dismiss="modal">Close</button> </div> </div> </div> </div> <script src="/sites/pearcesfurniture/includes/themes/MuraBootstrap4/assets/bootstrap/js/bootstrap.bundle.min.js"></script> <script src="//www.pearcesfurniture.com/core/modules/v1/cta/js/mura.displayobject.cta.min.js" defer="defer"></script></body> </html> <div id="myModal" class="modal fade"> <div class="modal-dialog"> <div class="modal-content"> <div class="modal-header"> <h5 class="modal-title">Chairs America</h5> <button type="button" class="close" data-dismiss="modal" aria-label="Close"> <span aria-hidden="true">&times;</span> </button> </div> <div class="modal-body">

Call us for information about Chairs America 912-586-2271 (they do not currently have a website)

</div> <div class="modal-footer"> <button class="btn btn-primary" data-dismiss="modal">Close</button> </div> </div> </div> </div>) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(component, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(contentBean, CFC: mura.content.contentBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(contentRenderer, CFC: muraWRM.sites.pearcesfurniture.contentRenderer) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(crumbdata, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(currentFilenameAdjusted, ) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(forcessl, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(isOnDisplay, 1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(localHandler, CFC: muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(muraAllowComments, 1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(muraSiteIDRedirect, false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(r, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(themePath, /sites/pearcesfurniture/includes/themes/MuraBootstrap4) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | setValue(track, 0) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | valueExists(contentBean) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | valueExists(localHandler) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc | valueExists(previewID) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/servletEvent.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getAPI(json, v1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getApi(feed, v1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getAssetMap() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getCacheFactory() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getCacheFactory(name = data) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 7 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getCacheFactory(name = output) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getDisplayObject(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getDisplayObject(component) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getTemplateIncludePath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getThemeAssetMap() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getThemeAssetPath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getThemeIncludePath() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getUseSSL() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(JSDateKeyObjInc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(RBFactory) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(isRemote) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(property = isRemote, defaultValue = false) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(reCAPTCHALanguage) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(site) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(templateIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 18 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | getValue(themeIncludePath) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | hasDisplayObject(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 9 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | isValidDomain(domain = www.pearcesfurniture.com, mode = complete) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | isValidDomain(domain = www.pearcesfurniture.com, mode = either, enforcePrimaryDomain = true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupContentTypeFilePath(page/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupContentTypeFilePath(pagedefault/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(PageDefault/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(Page_Default/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(component/index.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(custom/extensions/dsp_Page_Default.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(customOnly = true, filePath = component/../dsp_template.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(extensions/dsp_Component_Default.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(extensions/dsp_Page_Default.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupDisplayObjectFilePath(object/meta.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc | lookupHTMLHeadQueueFilePath(global.cfm) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsGateway.cfc | getList(orderno, asc, true) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsGateway.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | setConfigBean(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | setValue(siteid, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsImageSizeBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(WesternSizzlin) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(YKH) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(default) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(donerightcleaningllc) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(srsalute) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(testwebe) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(wcrd) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | getSite(ykt) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc | validate() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/settings/settingsManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc | init() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc | isLoggedIn() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/sessionUserFacade.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | init(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | onMissingMethod(1) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | setConfigBean(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | setSettingsManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | setSiteID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | setUserManager(argumentCollection = [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userBean.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc | getSession() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc | setUserStructDefaults() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userManager.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/user/userUtility.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/user/userUtility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | createCSSHook(Home) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | getUUID() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isHTTPS() ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onComponentDefaultBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onDisplayRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onGlobalMobileDetection) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onGlobalRequestEnd) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onGlobalRequestStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onPageBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onPageDefaultBodyRender) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onRenderEnd) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onRenderStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onSiteRequestInit) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | isValidCFVariableName(onSiteRequestStart) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc | valueExists(siteid) ] from C:/inetpub/wwwroot/clients/mura7/core/mura/utility.cfc
0 ms 0 ms 20 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getEvent() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 39 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getMuraScope() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getNavOffSet() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | getValue(crumbdata) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod($, CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ABREADCRUMBCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ABREADCRUMBNOTCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ACONTENTLISTCURRENTATTRIBUTES, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ACONTENTLISTCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ACONTENTLISTNOTCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ACURRENTCLASS, nav-link active) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ACURRENTCUSTOMSTRING, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ADDFEEDBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ADDFEEDBUTTONWRAPPERDIVCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ADDFEEDBUTTONWRAPPERDIVINNERCLASS, col-lg-2) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AHASKIDSCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AHASKIDSCUSTOMSTRING, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ALERTDANGERCLASS, alert alert-danger) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ALERTINFOCLASS, alert alert-info) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ALERTSUCCESSCLASS, alert alert-success) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ALERTWARNINGCLASS, alert alert-warning) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AMETALISTCURRENTATTRIBUTES, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AMETALISTCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AMETALISTNOTCURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ANOTCURRENTCLASS, nav-link) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(APAGINATIONCURRENTCLASS, page-link) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(APAGINATIONNOTCURRENTCLASS, page-link) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(APPROVECOMMENTLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(AVGRATINGWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(BODYMETAIMAGECLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CALENDARLISTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CALENDARTABLECLASS, table table-bordered table-striped) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CALENDARWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CATEGORIESNESTCHECKBOXCLASS, checkbox) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTADMINBUTTONWRAPPERCLASS, btn-group pull-right) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTAPPROVEBUTTONCLASS, btn btn-default btn-sm) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTAWAITINGAPPROVAL, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTCHECKBOXCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTDATETIMECLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTDELETEBUTTONCLASS, btn btn-default btn-sm) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTEDITBUTTONCLASS, btn btn-default btn-sm) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTFIELDLABELCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTFIELDWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTFORMCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTFORMWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTINPUTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTMORECOMMENTSCONTAINER, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTMORECOMMENTSDOWNCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTMORECOMMENTSUPCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTNEWCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTPREFSINPUTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTREPLYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTREQUIREDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSORTCONTAINERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSORTSELECTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSORTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSPAMCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSPAMLINKCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSUBMITBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSUBMITBUTTONWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTSWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(COMMENTUSEREMAILCLASS, btn btn-default btn-sm) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CONTENTLISTIMAGEPADDING, 20) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CONTENTLISTIMAGESTYLES, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CONTENTLISTPROPERTYMAP, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(CONTENTLISTWRAPPERDIVCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DATARESPONSELISTCLASS, dl-horizontal) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DATARESPONSEPAGINATIONCLASS, pagination) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DATARESPONSETABLECLASS, table table-hover) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DEFERMURAJS, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DELETECOMMENTLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXADDFEEDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXHEADERBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXHEADERCLASS, col-lg-12) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXNEWFEEDFORMCLASS, form-horizontal) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXRSSWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXSELECTFEEDMENUCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXSELECTFEEDMENUDIVCLASS, col-lg-10) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXSELECTFEEDROWCLASS, row) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXSELECTFEEDWRAPPERCLASS, col-lg-6) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEBOXWRAPPERCLASS, row) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(DRAGGABLEFEEDMENUSELECTFIELDCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEEXTATTRIBUTEDOWNLOADBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEEXTATTRIBUTEFILEWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEFIELDLABELCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEFORMCLASS, form-horizontal) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEFORMFIELDSCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEFORMFIELDSWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEFORMGROUPWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEHELPBLOCKCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILESUBMITBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILESUBMITBUTTONWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILESUCCESSMESSAGECLASS, alert alert-success) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EDITPROFILEWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EMAILDROPDOWNSELECTCLASS, dropdown) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EMAILLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ESAPIENCODE, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EVENTREMINDERFIELDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EVENTREMINDERFORMCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EVENTREMINDERFORMLABELSCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EVENTREMINDERFORMWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(EVENTREMINDERSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FEATURESWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FOLDERWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORGOTPASSWORDFORMCLASS, form-horizontal form-sendlogin) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERBUTTONWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERCHECKBOXCLASS, checkbox) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERDISABLEDINPUTCLASS, disabled) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERFIELDWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERFORMFIELDSCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUILDERTABHEADERCLASS, dropdown) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTOMSUBMITCLASS, form-submit btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONBACKCLASS, form-nav) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONBACKLABEL, Back) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONCANCELCLASS, form-cancel btn btn-danger) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONCANCELLABEL, Cancel) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONINNERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONNEXTCLASS, form-nav) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONNEXTLABEL, Next) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONSUBMITLABEL, Submit) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMBUTTONWRAPPERCLASS, btn-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMCHECKBOXCLASS, form-check-input) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMCHECKBOXLABELCLASS, form-check-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMCHECKBOXWRAPPERCLASS, form-check) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMERRORWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMFIELDLABELCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMFIELDWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMGENERALCONTROLCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMINPUTWRAPPERCLASS, input-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMRADIOCLASS, form-check-input) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMRADIOLABELCLASS, form-check-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMRADIOWRAPPERCLASS, form-check) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMREQUIREDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMRESPONSEWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMSELECTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMTEXTAREACLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(FORMWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(GALLERYTHUMBNAILCLASS, thumbnail) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(GALLERYULCLASS, clearfix) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(GALLERYWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(GENERALWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(GENERALWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(HEADLINE, h1) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(IMAGECLASS, img-thumbnail) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(JSLIB, jquery) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(JSLIBLOADED, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LAYOUTMANAGER, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LEGACYOBJECTS, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIBREADCRUMBCURRENTCLASS, breadcrumb-item active) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIBREADCRUMBNOTCURRENTCLASS, breadcrumb-item) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LICURRENTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LICURRENTCUSTOMSTRING, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIHASKIDSCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIHASKIDSCUSTOMSTRING, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LINESTEDCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIPAGINATIONCURRENTCLASS, page-item active) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LIPAGINATIONNOTCURRENTCLASS, page-item) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOCALINDEXWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMCHECKBOXCLASS, checkbox) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMCLASS, form-horizontal form-signin) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMFIELDCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMFIELDLABELCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMFIELDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMGROUPWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMPREFSCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINFORMSUBMITWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(LOGINWRAPPERINNERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTCHECKBOXCLASS, checkbox) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTCHECKBOXWRAPPERCLASS, col-lg-offset-2 col-lg-10) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTFORMCLASS, form-horizontal) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTFORMFIELDWRAPPERCLASS, col-lg-10) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTFORMGROUPWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTFORMINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTFORMLABELCLASS, control-label col-lg-2) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTSUBMITWRAPPERCLASS, col-lg-offset-2 col-lg-10) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(MAILINGLISTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVARCHIVEWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVARCHIVEWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVBREADCRUMBULCLASS, breadcrumb) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVCALENDARTABLECLASS, table table-bordered) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVCALENDARWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVCATEGORYWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVCATEGORYWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVFOLDERWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVFOLDERWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVLICLASS, nav-item) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVMULTILEVELWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVMULTILEVELWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVNEXTDECORATION, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVPEERWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVPEERWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVPREVDECORATION, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSEQUENTIALULCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSEQUENTIALWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSTANDARDWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSTANDARDWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSUBWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVSUBWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVWRAPPERBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NAVWRAPPERCLASS, mura-nav bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NEXTNINNERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NEXTNWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(NOTREGISTEREDLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(PAGETOOLSWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(PRELOADERMARKUP, <i class="mura-preloader fa fa-refresh fa-spin">) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(RATEROBJECTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(RATERWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(REMOTEFEEDWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAINBUTTONWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAINFORMCLASS, navbar-form) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAINFORMINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAININNERCLASS, card-body) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAININPUTWRAPPERCLASS, input-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAINROWCLASS, card) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHAGAINSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHFORMCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHFORMINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHFORMINPUTWRAPPERCLASS, input-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHFORMSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHFORMSUBMITWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTINNERCLASS, lead) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTSLISTCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTSMORERESULTSROWCLASS, bg-light py-2 px-3 mb-3 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTSPAGERCLASS, pager) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTSROWCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHRESULTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SEARCHSHOWNUMBERS, 0) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SUBHEAD1, h2) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SUBHEAD2, h3) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SUBHEAD3, h4) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SUBHEAD4, h5) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(SUPPRESSWHITESPACE, false) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLEBODYCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLECELLCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLECLASS, table table-bordered table-striped) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLEFOOTERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLEHEADCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLEHEADERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TABLEROWCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(TAGCLOUDWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ULNESTEDCLASS, nav flex-column ml-3 bl-1) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ULNESTEDCUSTOMSTRING, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ULPAGINATIONCLASS, pagination) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ULPAGINATIONWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(ULTOPCLASS, nav flex-column) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERFAVORITESWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSEDITPROFILELINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSFORMGROUPWRAPPERCLASS, form-group) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMCHECKBOXCLASS, checkbox) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMFIELDINNERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMINPUTCLASS, form-control) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMINPUTWRAPPERCLASS, ) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMLABELCLASS, control-label) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINFORMSUBMITCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGINWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSLOGOUTLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSNOTREGISTEREDLINKCLASS, btn btn-primary) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(USERTOOLSWRAPPERCLASS, bg-light p-3 mb-5 border rounded) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(VALIDATECSRFTOKENS, true) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(commitTracePoint, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(convertTimezone, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 2 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(crumbdata, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(deleteMethod, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(dspCarouselByFeedName, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(dspPrimaryNavKids, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(event, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(get, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getAsJSON, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getAsStruct, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getBean, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getConfigBean, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getCurrentUser, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getEntity, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getEventManager, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getFeed, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getHTTPAttrs, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getHTTPService, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getJavaTimezone, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getPlugin, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getPluginManager, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getQueryAttrs, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getQueryService, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getServiceFactory, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getSession, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(getValue, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(hasCustomDatasource, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(init, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(initTracePoint, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(inject, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(injectMethod, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(invokeMethod, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(mixin, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(mura, CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(parseDateArg, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(removeValue, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(set, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(setValue, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | injectMethod(valueExists, [complex value]) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 4 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodArguments = [complex value], methodName = renderCssStyles) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodName = getClientRenderVariables) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | invokeMethod(methodName = getMuraJSDeferredString) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 6 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | onMissingMethod() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 3 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | setDynamicContent(?display=login) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | setValue(siteid, pearcesfurniture) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 5 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | useLayoutManager() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | useLayoutmanager() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc | uselayoutmanager() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/eventHandler.cfc | init() ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/eventHandler.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/eventHandler.cfc | setValue(_objectName, muraWRM.sites.pearcesfurniture.eventHandler) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/eventHandler.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc | init(mura = CFC: mura.MuraScope, $ = CFC: mura.MuraScope, event = CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc | injectMethod($, CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc | injectMethod(event, CFC: mura.servletEvent) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc
0 ms 0 ms 1 CFC[ C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc | injectMethod(mura, CFC: mura.MuraScope) ] from C:/inetpub/wwwroot/clients/mura7/sites/pearcesfurniture/includes/themes/MuraBootstrap4/contentRenderer.cfc
20 ms  STARTUP, PARSING, COMPILING, LOADING, & SHUTDOWN
4334 ms  TOTAL EXECUTION TIME
red = over 250 ms average execution time


Exceptions

13:26:21.021 - Expression Exception - in C:/inetpub/wwwroot/clients/mura7/core/mura/backport/backport.cfm : line 12
	    Variable ESAPIENCODE is undefined.
	    


SQL Queries

rsCommands (Datasource=mura7, Time=2ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\cluster\clusterManager.cfc @ 13:26:21.021
			select * from tclustercommands
				where instanceID=?
				and created <? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = E36BCDB0-155D-6942-027BF34578E1D903
Parameter #2(cf_sql_timestamp) = 2019-07-21 13:26:21.414

find (Datasource=mura7, Time=0ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\Portcullis.cfc @ 13:26:21.021
			SELECT blocked
			FROM variables.internal.iplog
			WHERE IP = ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 35.171.183.163

rsUser (Datasource=mura7, Time=2ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\user\userDAO.cfc @ 13:26:21.021
			select tusers.userID, tusers.GroupName, tusers.Fname, tusers.Lname, tusers.UserName,tusers.PasswordCreated, tusers.Email, tusers.Company, tusers.JobTitle, tusers.MobilePhone, tusers.Website, tusers.Type, tusers.subType, tusers.ContactForm, tusers.S2, tusers.LastLogin, tusers.LastUpdate, tusers.LastUpdateBy, tusers.LastUpdateByID, tusers.Perm, tusers.InActive, tusers.IsPublic, tusers.SiteID, tusers.Subscribe, tusers.Notes, tusers.description, tusers.Interests, tusers.keepPrivate, tusers.PhotoFileID, tusers.IMName, tusers.IMService, tusers.Created, tusers.RemoteID, tusers.Tags, tusers.tablist, tfiles.fileEXT photoFileExt
			from tusers
			left join tfiles on tusers.photoFileId=tfiles.fileid
			where tusers.userid= ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) =

rsExtended (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendData.cfc @ 13:26:21.021
			select tclassextenddatauseractivity.baseid, tclassextendattributes.name, tclassextendattributes.type, tclassextendattributes.validation,
			
				tclassextendattributes.label
			,
			tclassextendattributes.attributeID,tclassextendattributes.defaultValue,tclassextendattributes.extendSetID,

			tclassextenddatauseractivity.attributeValue, tclassextenddatauseractivity.datetimevalue

			from tclassextenddatauseractivity 
			inner join tclassextendattributes  On (tclassextenddatauseractivity.attributeID=tclassextendattributes.attributeID)
			where tclassextenddatauseractivity.baseID=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = D7B29B31-155D-6942-02D9D0F9F6EC4F70

rsContent (Datasource=mura7, Time=3ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentDAO.cfc @ 13:26:21.021
					select tcontent.Active,tcontent.Approved,tcontent.audience,tcontent.Body,tcontent.ContentHistID,
tcontent.ContentID,tcontent.Credits,tcontent.Display,tcontent.DisplayStart,tcontent.DisplayStop,tcontent.featureStart,
tcontent.featureStop,tcontent.FileID,tcontent.Filename,tcontent.forceSSL,tcontent.inheritObjects,tcontent.isFeature,
tcontent.IsLocked,tcontent.IsNav,tcontent.keyPoints,tcontent.lastUpdate,tcontent.lastUpdateBy,tcontent.lastUpdateByID,
tcontent.MenuTitle,tcontent.MetaDesc,tcontent.MetaKeyWords,tcontent.moduleAssign,tcontent.ModuleID,tcontent.nextN,
tcontent.Notes,tcontent.OrderNo,tcontent.ParentID,tcontent.displayTitle,tcontent.ReleaseDate,tcontent.RemoteID,
tcontent.RemotePubDate,tcontent.RemoteSource,tcontent.RemoteSourceURL,tcontent.RemoteURL,tcontent.responseChart,
tcontent.responseDisplayFields,tcontent.responseMessage,tcontent.responseSendTo,tcontent.Restricted,tcontent.RestrictGroups,
tcontent.searchExclude,tcontent.SiteID,tcontent.sortBy,tcontent.sortDirection,tcontent.Summary,tcontent.Target,
tcontent.TargetParams,tcontent.Template,tcontent.Title,tcontent.Type,tcontent.subType,tcontent.Path,tcontent.tags,
tcontent.doCache,tcontent.created,tcontent.urltitle,tcontent.htmltitle,tcontent.mobileExclude,tcontent.changesetID,
tcontent.imageSize,tcontent.imageHeight,tcontent.imageWidth,tcontent.childTemplate,tcontent.majorVersion,tcontent.minorVersion,tcontent.expires,tcontent.displayInterval,tcontent.objectParams
, tfiles.fileSize,
					tfiles.contentType, tfiles.contentSubType, tfiles.fileExt,tfiles.filename as assocFilename,
				tapprovalrequests.status as approvalStatus, tapprovalrequests.requestID,tapprovalrequests.groupid as approvalGroupID
					from tcontent
					left join tfiles on (tcontent.fileid=tfiles.fileid)
					left join tapprovalrequests on (tcontent.contenthistid=tapprovalrequests.contenthistid)
					where tcontent.contentid=? 
			and tcontent.active = 1
		
					and tcontent.siteid=?
					and type in ('Page','Folder','File','Calendar','Link','Gallery','Component','Form','Variation','Module')
				
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000001
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsCrumbData (Datasource=mura7, Time=3ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentGatewayAdobe.cfc @ 13:26:22.022
			select tcontent.contenthistid, tcontent.contentid,tcontent.title, tcontent.menutitle,tcontent.urltitle, tcontent.filename, tcontent.parentid, tcontent.type,
			tcontent.subtype, tcontent.target, tcontent.targetParams,
			tcontent.siteid, tcontent.restricted, tcontent.restrictgroups,tcontent.template,tcontent.childTemplate,tcontent.inheritObjects,tcontent.metadesc,tcontent.metakeywords,tcontent.sortBy,
			tcontent.sortDirection,tapprovalassignments.chainID,
			
			length(tcontent.path) depth
			
			,tfiles.fileExt,tapprovalassignments.exemptID,tcontent.moduleid

			from tcontent
			left join tfiles on(tcontent.fileID=tfiles.fileID)
			left join tapprovalassignments on (tcontent.contentid=tapprovalassignments.contentid
											and tcontent.siteID=tapprovalassignments.siteID)
			where
			tcontent.contentID in (?)
			and tcontent.active=1
			and tcontent.siteid= ?
			order by depth desc
			
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000001
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsModulePerm (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\permission.cfc @ 13:26:22.022
			select tusers.groupname,isPublic from tusers INNER JOIN tpermissions ON (tusers.userid = tpermissions.groupid) where tpermissions.contentid=? and tpermissions.siteid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000000
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsFeeds (Datasource=mura7, Time=2ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:22.022
	select * from tcontentfeeds
	where siteID= ?
	and Type= ? 
	and isPublic=1
	
	and isactive=1
	
	order by name
	
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = Local

rsKids (Datasource=mura7, Time=8ms, Records=5) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentGatewayAdobe.cfc @ 13:26:22.022
				SELECT 
				tcontent.title, tcontent.releasedate, tcontent.menuTitle, tcontent.lastupdate,tcontent.summary, tcontent.tags,tcontent.filename, tcontent.type,tcontent.subType, tcontent.siteid,
				tcontent.contentid, tcontent.contentHistID, tcontent.target, tcontent.targetParams,
				tcontent.restricted, tcontent.restrictgroups, tcontent.displaystart, tcontent.displaystop, tcontent.orderno,tcontent.sortBy,tcontent.sortDirection,
				tcontent.fileid, tcontent.credits, tcontent.remoteSource, tcontent.remoteSourceURL, tcontent.remoteURL,
				tfiles.fileSize,tfiles.fileExt, tcontent.audience, tcontent.keypoints
				,tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes
				,tcontentstats.comments, '' as parentType, null as kids,tcontent.path, tcontent.created, tcontent.nextn,
				tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
				tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
				
				FROM  tcontent 
					Left Join tfiles  ON (tcontent.fileID=tfiles.fileID)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				

				WHERE
				    tcontent.parentid = ? 
			and tcontent.active = 1
			and tcontent.Approved = 1
		
					AND tcontent.isNav = 1
					AND tcontent.moduleid = ?
					AND tcontent.siteid = ? 

					AND (
					   	

					 	tcontent.Display = 1
					  	OR
					  	(
					  		tcontent.Display = 2
					 		AND
					 	 		(
					 	 			tcontent.DisplayStart <{ts '2019-07-21 13:25:00'}
						  			AND
						  				(
						  					tcontent.DisplayStop >= {ts '2019-07-21 13:25:00'} or tcontent.DisplayStop is null
						  				)
						  		)
						)

					  
		  				)

					
	and (tcontent.mobileExclude is null
		OR
		
			tcontent.mobileExclude in (0,1)
		
	)
	

				order by

				
						tcontent.orderno asc 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000001
Parameter #2(cf_sql_varchar) = 00000000000000000000000000000000000
Parameter #3(cf_sql_varchar) = pearcesfurniture

rsHome (Datasource=mura7, Time=2ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentRenderer.cfc @ 13:26:22.022
					select menutitle,filename from tcontent where contentID=? and siteid=? and active=1
					
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000001
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsFeed (Datasource=mura7, Time=6ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:22.022
			SELECT
				
						tcontent.siteid, tcontent.title, tcontent.menutitle, tcontent.restricted, tcontent.restrictgroups,
						tcontent.type, tcontent.subType, tcontent.filename, tcontent.displaystart, tcontent.displaystop,
						tcontent.remotesource, tcontent.remoteURL,tcontent.remotesourceURL, tcontent.keypoints,
						tcontent.contentID, tcontent.parentID, tcontent.approved, tcontent.isLocked, tcontent.contentHistID,tcontent.target, tcontent.targetParams,
						tcontent.releaseDate, tcontent.lastupdate,tcontent.summary,
						tfiles.fileSize,tfiles.fileExt,tcontent.fileid,
						tcontent.tags,tcontent.credits,tcontent.audience, tcontent.orderNo,
						tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes,
						tcontentstats.comments, tparent.type parentType,
						tcontent.path, tcontent.created, tcontent.nextn, tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
						tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
					

			FROM
				 tcontent 
					left Join tfiles  on (tcontent.fileid=tfiles.fileid)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontent tparent  on (tcontent.parentid=tparent.contentid
						and tcontent.siteid=tparent.siteid
						and tparent.active=1)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				

			WHERE
				tcontent.siteid in (?)
				
				and tcontent.active = 1
				and tcontent.Approved = 1 
					AND tcontent.isNav = 1
				
					AND tcontent.moduleid = '00000000000000000000000000000000000'
				
					AND tcontent.searchExclude = 0
				
					AND tcontent.contentid <> '00000000000000000000000000000000001'
				

				AND tcontent.type <>'Module'

				
				
					and tcontent.parentid in (
					?,
					'')
				
					AND (
						tcontent.Display = 1
						OR
							(
								tcontent.Display = 2


								AND
								(

									(   
											tparent.type!='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									) OR (
										
											tparent.type='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									)
								)
							)

					)

					AND (
						tcontent.mobileExclude is null
						OR
						
							tcontent.mobileExclude in (0,1)
						
					)
				
						order by

						
										tcontent.orderno asc 
						limit ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = F945E9B5-155D-6942-02119AD8304874A1
Parameter #3(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #4(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #5(cf_sql_timestamp) = 2020-07-21 13:25:00.0
Parameter #6(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #7(cf_sql_integer) = 20

rsFeed (Datasource=mura7, Time=6ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:22.022
			SELECT
				
						tcontent.siteid, tcontent.title, tcontent.menutitle, tcontent.restricted, tcontent.restrictgroups,
						tcontent.type, tcontent.subType, tcontent.filename, tcontent.displaystart, tcontent.displaystop,
						tcontent.remotesource, tcontent.remoteURL,tcontent.remotesourceURL, tcontent.keypoints,
						tcontent.contentID, tcontent.parentID, tcontent.approved, tcontent.isLocked, tcontent.contentHistID,tcontent.target, tcontent.targetParams,
						tcontent.releaseDate, tcontent.lastupdate,tcontent.summary,
						tfiles.fileSize,tfiles.fileExt,tcontent.fileid,
						tcontent.tags,tcontent.credits,tcontent.audience, tcontent.orderNo,
						tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes,
						tcontentstats.comments, tparent.type parentType,
						tcontent.path, tcontent.created, tcontent.nextn, tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
						tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
					

			FROM
				 tcontent 
					left Join tfiles  on (tcontent.fileid=tfiles.fileid)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontent tparent  on (tcontent.parentid=tparent.contentid
						and tcontent.siteid=tparent.siteid
						and tparent.active=1)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				

			WHERE
				tcontent.siteid in (?)
				
				and tcontent.active = 1
				and tcontent.Approved = 1 
					AND tcontent.isNav = 1
				
					AND tcontent.moduleid = '00000000000000000000000000000000000'
				
					AND tcontent.searchExclude = 0
				
					AND tcontent.contentid <> '00000000000000000000000000000000001'
				

				AND tcontent.type <>'Module'

				
				
					and tcontent.parentid in (
					?,
					'')
				
					AND (
						tcontent.Display = 1
						OR
							(
								tcontent.Display = 2


								AND
								(

									(   
											tparent.type!='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									) OR (
										
											tparent.type='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									)
								)
							)

					)

					AND (
						tcontent.mobileExclude is null
						OR
						
							tcontent.mobileExclude in (0,1)
						
					)
				
						order by

						
										tcontent.orderno asc 
						limit ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = F93D7187-155D-6942-02FC18F9920BE42D
Parameter #3(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #4(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #5(cf_sql_timestamp) = 2020-07-21 13:25:00.0
Parameter #6(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #7(cf_sql_integer) = 20

rsFeed (Datasource=mura7, Time=6ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:23.023
			SELECT
				
						tcontent.siteid, tcontent.title, tcontent.menutitle, tcontent.restricted, tcontent.restrictgroups,
						tcontent.type, tcontent.subType, tcontent.filename, tcontent.displaystart, tcontent.displaystop,
						tcontent.remotesource, tcontent.remoteURL,tcontent.remotesourceURL, tcontent.keypoints,
						tcontent.contentID, tcontent.parentID, tcontent.approved, tcontent.isLocked, tcontent.contentHistID,tcontent.target, tcontent.targetParams,
						tcontent.releaseDate, tcontent.lastupdate,tcontent.summary,
						tfiles.fileSize,tfiles.fileExt,tcontent.fileid,
						tcontent.tags,tcontent.credits,tcontent.audience, tcontent.orderNo,
						tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes,
						tcontentstats.comments, tparent.type parentType,
						tcontent.path, tcontent.created, tcontent.nextn, tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
						tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
					

			FROM
				 tcontent 
					left Join tfiles  on (tcontent.fileid=tfiles.fileid)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontent tparent  on (tcontent.parentid=tparent.contentid
						and tcontent.siteid=tparent.siteid
						and tparent.active=1)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				

			WHERE
				tcontent.siteid in (?)
				
				and tcontent.active = 1
				and tcontent.Approved = 1 
					AND tcontent.isNav = 1
				
					AND tcontent.moduleid = '00000000000000000000000000000000000'
				
					AND tcontent.searchExclude = 0
				
					AND tcontent.contentid <> '00000000000000000000000000000000001'
				

				AND tcontent.type <>'Module'

				
				
					and tcontent.parentid in (
					?,
					'')
				
					AND (
						tcontent.Display = 1
						OR
							(
								tcontent.Display = 2


								AND
								(

									(   
											tparent.type!='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									) OR (
										
											tparent.type='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									)
								)
							)

					)

					AND (
						tcontent.mobileExclude is null
						OR
						
							tcontent.mobileExclude in (0,1)
						
					)
				
						order by

						
										tcontent.orderno asc 
						limit ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = F94003D1-155D-6942-0283541BE32EBA2E
Parameter #3(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #4(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #5(cf_sql_timestamp) = 2020-07-21 13:25:00.0
Parameter #6(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #7(cf_sql_integer) = 20

rsFeed (Datasource=mura7, Time=5ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:23.023
			SELECT
				
						tcontent.siteid, tcontent.title, tcontent.menutitle, tcontent.restricted, tcontent.restrictgroups,
						tcontent.type, tcontent.subType, tcontent.filename, tcontent.displaystart, tcontent.displaystop,
						tcontent.remotesource, tcontent.remoteURL,tcontent.remotesourceURL, tcontent.keypoints,
						tcontent.contentID, tcontent.parentID, tcontent.approved, tcontent.isLocked, tcontent.contentHistID,tcontent.target, tcontent.targetParams,
						tcontent.releaseDate, tcontent.lastupdate,tcontent.summary,
						tfiles.fileSize,tfiles.fileExt,tcontent.fileid,
						tcontent.tags,tcontent.credits,tcontent.audience, tcontent.orderNo,
						tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes,
						tcontentstats.comments, tparent.type parentType,
						tcontent.path, tcontent.created, tcontent.nextn, tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
						tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
					

			FROM
				 tcontent 
					left Join tfiles  on (tcontent.fileid=tfiles.fileid)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontent tparent  on (tcontent.parentid=tparent.contentid
						and tcontent.siteid=tparent.siteid
						and tparent.active=1)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				

			WHERE
				tcontent.siteid in (?)
				
				and tcontent.active = 1
				and tcontent.Approved = 1 
					AND tcontent.isNav = 1
				
					AND tcontent.moduleid = '00000000000000000000000000000000000'
				
					AND tcontent.searchExclude = 0
				
					AND tcontent.contentid <> '00000000000000000000000000000000001'
				

				AND tcontent.type <>'Module'

				
				
					and tcontent.parentid in (
					?,
					'')
				
					AND (
						tcontent.Display = 1
						OR
							(
								tcontent.Display = 2


								AND
								(

									(   
											tparent.type!='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									) OR (
										
											tparent.type='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									)
								)
							)

					)

					AND (
						tcontent.mobileExclude is null
						OR
						
							tcontent.mobileExclude in (0,1)
						
					)
				
						order by

						
										tcontent.orderno asc 
						limit ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = F941BE1D-155D-6942-021DC63527705604
Parameter #3(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #4(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #5(cf_sql_timestamp) = 2020-07-21 13:25:00.0
Parameter #6(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #7(cf_sql_integer) = 20

rsCrumbData (Datasource=mura7, Time=3ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentGatewayAdobe.cfc @ 13:26:23.023
			select tcontent.contenthistid, tcontent.contentid,tcontent.title, tcontent.menutitle,tcontent.urltitle, tcontent.filename, tcontent.parentid, tcontent.type,
			tcontent.subtype, tcontent.target, tcontent.targetParams,
			tcontent.siteid, tcontent.restricted, tcontent.restrictgroups,tcontent.template,tcontent.childTemplate,tcontent.inheritObjects,tcontent.metadesc,tcontent.metakeywords,tcontent.sortBy,
			tcontent.sortDirection,tapprovalassignments.chainID,
			
			length(tcontent.path) depth
			
			,tfiles.fileExt,tapprovalassignments.exemptID,tcontent.moduleid

			from tcontent
			left join tfiles on(tcontent.fileID=tfiles.fileID)
			left join tapprovalassignments on (tcontent.contentid=tapprovalassignments.contentid
											and tcontent.siteID=tapprovalassignments.siteID)
			where
			tcontent.contentID in (?)
			and tcontent.active=1
			and tcontent.siteid= ?
			order by depth desc
			
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 00000000000000000000000000000000001
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsPage (Datasource=mura7, Time=2ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentDAO.cfc @ 13:26:23.023
					select tcontent.Active,tcontent.Approved,tcontent.audience,tcontent.Body,tcontent.ContentHistID,
tcontent.ContentID,tcontent.Credits,tcontent.Display,tcontent.DisplayStart,tcontent.DisplayStop,tcontent.featureStart,
tcontent.featureStop,tcontent.FileID,tcontent.Filename,tcontent.forceSSL,tcontent.inheritObjects,tcontent.isFeature,
tcontent.IsLocked,tcontent.IsNav,tcontent.keyPoints,tcontent.lastUpdate,tcontent.lastUpdateBy,tcontent.lastUpdateByID,
tcontent.MenuTitle,tcontent.MetaDesc,tcontent.MetaKeyWords,tcontent.moduleAssign,tcontent.ModuleID,tcontent.nextN,
tcontent.Notes,tcontent.OrderNo,tcontent.ParentID,tcontent.displayTitle,tcontent.ReleaseDate,tcontent.RemoteID,
tcontent.RemotePubDate,tcontent.RemoteSource,tcontent.RemoteSourceURL,tcontent.RemoteURL,tcontent.responseChart,
tcontent.responseDisplayFields,tcontent.responseMessage,tcontent.responseSendTo,tcontent.Restricted,tcontent.RestrictGroups,
tcontent.searchExclude,tcontent.SiteID,tcontent.sortBy,tcontent.sortDirection,tcontent.Summary,tcontent.Target,
tcontent.TargetParams,tcontent.Template,tcontent.Title,tcontent.Type,tcontent.subType,tcontent.Path,tcontent.tags,
tcontent.doCache,tcontent.created,tcontent.urltitle,tcontent.htmltitle,tcontent.mobileExclude,tcontent.changesetID,
tcontent.imageSize,tcontent.imageHeight,tcontent.imageWidth,tcontent.childTemplate,tcontent.majorVersion,tcontent.minorVersion,tcontent.expires,tcontent.displayInterval,tcontent.objectParams
, tfiles.fileSize,
					tfiles.contentType, tfiles.contentSubType, tfiles.fileExt,tfiles.filename as assocFilename,
					tapprovalrequests.status as approvalStatus, tapprovalrequests.requestID,tapprovalrequests.groupid as approvalGroupID
					 from tcontent
					left join tfiles on (tcontent.fileid=tfiles.fileid)
					left join tapprovalrequests on (tcontent.contenthistid=tapprovalrequests.contenthistid)
					where
					tcontent.contenthistid in (?)
				
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 942DF1F7-155D-6942-02D12D1BD469D287

rsContent (Datasource=mura7, Time=0ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentDAO.cfc @ 13:26:23.023
				select * from rsPage where contenthistid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 942DF1F7-155D-6942-02D12D1BD469D287

rs (Datasource=mura7, Time=2ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\settings\settingsImageSizeBean.cfc @ 13:26:23.023
	select * from timagesizes
	where
	
	name=?
	and
	siteid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = carousel
Parameter #2(cf_sql_varchar) = pearcesfurniture

rs (Datasource=mura7, Time=1ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedDAO.cfc @ 13:26:23.023
	Select
	feedID,siteID,dateCreated,lastUpdate,lastUpdateBy,name,altName,lang,maxitems,isActive,isPublic,isDefault,description,allowHTML,isFeaturesOnly,restricted,restrictGroups,version,channelLink,type,sortBy,sortDirection,nextn,displayName,displayRatings,displayComments,parentID,remoteID,remoteSourceURL,remotePubDate,imageSize,imageHeight,imageWidth,displayList,showNavOnly,showExcludeSearch,viewalllink,viewalllabel,autoimport,isLocked,CssClass,useCategoryIntersect,contentpoolid,authtype
	from tcontentfeeds where
	name= ?
	and siteid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = carousel
Parameter #2(cf_sql_varchar) = pearcesfurniture

rs (Datasource=mura7, Time=1ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedDAO.cfc @ 13:26:23.023
		select itemID from tcontentfeeditems
		where feedID=? and type = ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 94500867-155D-6942-029B255B9E12D3B2
Parameter #2(cf_sql_varchar) = contentID

rs (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedDAO.cfc @ 13:26:23.023
		select itemID from tcontentfeeditems
		where feedID=? and type = ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 94500867-155D-6942-029B255B9E12D3B2
Parameter #2(cf_sql_varchar) = categoryID

rs (Datasource=mura7, Time=1ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedDAO.cfc @ 13:26:23.023
		select * from tcontentfeedadvancedparams
		where feedID=? order by param
	
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 94500867-155D-6942-029B255B9E12D3B2

rs (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendManager.cfc @ 13:26:23.023
				select validation from tclassextendattributes
				where
				
					siteID=?
					and name=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = random

rsFeed (Datasource=mura7, Time=8ms, Records=6) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\feed\feedGateway.cfc @ 13:26:23.023
			SELECT
				
						tcontent.siteid, tcontent.title, tcontent.menutitle, tcontent.restricted, tcontent.restrictgroups,
						tcontent.type, tcontent.subType, tcontent.filename, tcontent.displaystart, tcontent.displaystop,
						tcontent.remotesource, tcontent.remoteURL,tcontent.remotesourceURL, tcontent.keypoints,
						tcontent.contentID, tcontent.parentID, tcontent.approved, tcontent.isLocked, tcontent.contentHistID,tcontent.target, tcontent.targetParams,
						tcontent.releaseDate, tcontent.lastupdate,tcontent.summary,
						tfiles.fileSize,tfiles.fileExt,tcontent.fileid,
						tcontent.tags,tcontent.credits,tcontent.audience, tcontent.orderNo,
						tcontentstats.rating,tcontentstats.totalVotes,tcontentstats.downVotes,tcontentstats.upVotes,
						tcontentstats.comments, tparent.type parentType,
						tcontent.path, tcontent.created, tcontent.nextn, tcontent.majorVersion, tcontent.minorVersion, tcontentstats.lockID, tcontentstats.lockType, tcontent.expires,
						tfiles.filename as AssocFilename,tcontent.displayInterval,tcontent.display,tcontentfilemetadata.altText as fileAltText,tcontent.changesetid
					

			FROM
				 tcontent 
					left Join tfiles  on (tcontent.fileid=tfiles.fileid)
					left Join tcontentstats  on (tcontent.contentid=tcontentstats.contentid
						and tcontent.siteid=tcontentstats.siteid)
					Left Join tcontent tparent  on (tcontent.parentid=tparent.contentid
						and tcontent.siteid=tparent.siteid
						and tparent.active=1)
					Left Join tcontentfilemetadata  on (tcontent.fileid=tcontentfilemetadata.fileid
						and tcontent.contenthistid=tcontentfilemetadata.contenthistid
						and tcontent.siteid=tcontentfilemetadata.siteid)
				
					LEFT JOIN (
						SELECT
							stringvalue extendedSort,
							tclassextenddata.baseID
						FROM tclassextenddata 
							inner join tclassextendattributes 
								on (tclassextenddata.attributeID=tclassextendattributes.attributeID)
						WHERE tclassextendattributes.siteid in (?)
							AND tclassextendattributes.name=?
					) qExtendedSort
						ON (tcontent.contenthistid=qExtendedSort.baseID)
				

			WHERE
				tcontent.siteid in (?)
				
				and tcontent.active = 1
				and tcontent.Approved = 1 
					AND tcontent.isNav = 1
				
					AND tcontent.moduleid = '00000000000000000000000000000000000'
				
					AND tcontent.searchExclude = 0
				
					AND tcontent.contentid <> '00000000000000000000000000000000001'
				

				AND tcontent.type <>'Module'

				
				
					and tcontent.parentid in (
					?,
					'')
				
					AND (
						tcontent.Display = 1
						OR
							(
								tcontent.Display = 2


								AND
								(

									(   
											tparent.type!='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									) OR (
										
											tparent.type='Calendar'
										

										and tcontent.DisplayStart <= ?
										and (tcontent.DisplayStop >= ? or tcontent.DisplayStop is null)
									)
								)
							)

					)

					AND (
						tcontent.mobileExclude is null
						OR
						
							tcontent.mobileExclude in (0,1)
						
					)
				
						order by

						
										rand()
									
						limit ? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = random
Parameter #3(cf_sql_varchar) = pearcesfurniture
Parameter #4(cf_sql_varchar) = 901662A6-155D-6942-02E4B21B20EDE246
Parameter #5(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #6(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #7(cf_sql_timestamp) = 2020-07-21 13:25:00.0
Parameter #8(cf_sql_timestamp) = 2019-07-21 13:25:00.0
Parameter #9(cf_sql_integer) = 20

rsObjects (Datasource=mura7, Time=4ms, Records=2) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentGatewayAdobe.cfc @ 13:26:24.024
	select tcontentobjects.object,tcontentobjects.name,tcontentobjects.objectid, tcontentobjects.orderno, tcontentobjects.params, tplugindisplayobjects.configuratorInit from tcontentobjects
	inner join tcontent On(
	tcontentobjects.contenthistid=tcontent.contenthistid
	and tcontentobjects.siteid=tcontent.siteid)
	left join tplugindisplayobjects on (tcontentobjects.object='plugin'
										and tcontentobjects.objectID=tplugindisplayobjects.objectID)
	where tcontent.siteid='pearcesfurniture'
	and tcontent.contenthistid ='942DF1F7-155D-6942-02D12D1BD469D287'
	and tcontentobjects.columnid=2
	order by tcontentobjects.orderno
	
rsContent (Datasource=mura7, Time=2ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentDAO.cfc @ 13:26:24.024
					select tcontent.Active,tcontent.Approved,tcontent.audience,tcontent.Body,tcontent.ContentHistID,
tcontent.ContentID,tcontent.Credits,tcontent.Display,tcontent.DisplayStart,tcontent.DisplayStop,tcontent.featureStart,
tcontent.featureStop,tcontent.FileID,tcontent.Filename,tcontent.forceSSL,tcontent.inheritObjects,tcontent.isFeature,
tcontent.IsLocked,tcontent.IsNav,tcontent.keyPoints,tcontent.lastUpdate,tcontent.lastUpdateBy,tcontent.lastUpdateByID,
tcontent.MenuTitle,tcontent.MetaDesc,tcontent.MetaKeyWords,tcontent.moduleAssign,tcontent.ModuleID,tcontent.nextN,
tcontent.Notes,tcontent.OrderNo,tcontent.ParentID,tcontent.displayTitle,tcontent.ReleaseDate,tcontent.RemoteID,
tcontent.RemotePubDate,tcontent.RemoteSource,tcontent.RemoteSourceURL,tcontent.RemoteURL,tcontent.responseChart,
tcontent.responseDisplayFields,tcontent.responseMessage,tcontent.responseSendTo,tcontent.Restricted,tcontent.RestrictGroups,
tcontent.searchExclude,tcontent.SiteID,tcontent.sortBy,tcontent.sortDirection,tcontent.Summary,tcontent.Target,
tcontent.TargetParams,tcontent.Template,tcontent.Title,tcontent.Type,tcontent.subType,tcontent.Path,tcontent.tags,
tcontent.doCache,tcontent.created,tcontent.urltitle,tcontent.htmltitle,tcontent.mobileExclude,tcontent.changesetID,
tcontent.imageSize,tcontent.imageHeight,tcontent.imageWidth,tcontent.childTemplate,tcontent.majorVersion,tcontent.minorVersion,tcontent.expires,tcontent.displayInterval,tcontent.objectParams
, tfiles.fileSize,
					tfiles.contentType, tfiles.contentSubType, tfiles.fileExt,tfiles.filename as assocFilename,
				tapprovalrequests.status as approvalStatus, tapprovalrequests.requestID,tapprovalrequests.groupid as approvalGroupID
					from tcontent
					left join tfiles on (tcontent.fileid=tfiles.fileid)
					left join tapprovalrequests on (tcontent.contenthistid=tapprovalrequests.contenthistid)
					where tcontent.contentid=? 
			and tcontent.active = 1
		
					and tcontent.siteid=?
					and type in ('Page','Folder','File','Calendar','Link','Gallery','Component','Form','Variation','Module')
				
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 93BC28E7-155D-6942-024F839DCE550B35
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsExtended (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendData.cfc @ 13:26:24.024
			select tclassextenddata.baseid, tclassextendattributes.name, tclassextendattributes.type, tclassextendattributes.validation,
			
				tclassextendattributes.label
			,
			tclassextendattributes.attributeID,tclassextendattributes.defaultValue,tclassextendattributes.extendSetID,

			tclassextenddata.attributeValue, tclassextenddata.datetimevalue

			from tclassextenddata 
			inner join tclassextendattributes  On (tclassextenddata.attributeID=tclassextendattributes.attributeID)
			where tclassextenddata.baseID=? 
				and tclassextendattributes.siteid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 91E64550-155D-6942-0272DD25D4A39C0A
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsCombine (Datasource=mura7, Time=1ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendData.cfc @ 13:26:24.024
			select baseID, name, type, validation, label, attributeID, defaultValue, extendSetID, attributeValue
			from rsExtended

			union all

			select '' baseID, attributename as name, type, validation, label, attributeID, defaultValue, extendSetID, '' attributeValue
			from rsDefinitions
			where siteID=?
			and (
				type=? 
				)
          	and (
                 
                 subtype='Default'
                  )
			
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = Component

rsContent (Datasource=mura7, Time=2ms, Records=1) in C:\inetpub\wwwroot\clients\mura7\core\mura\content\contentDAO.cfc @ 13:26:25.025
					select tcontent.Active,tcontent.Approved,tcontent.audience,tcontent.Body,tcontent.ContentHistID,
tcontent.ContentID,tcontent.Credits,tcontent.Display,tcontent.DisplayStart,tcontent.DisplayStop,tcontent.featureStart,
tcontent.featureStop,tcontent.FileID,tcontent.Filename,tcontent.forceSSL,tcontent.inheritObjects,tcontent.isFeature,
tcontent.IsLocked,tcontent.IsNav,tcontent.keyPoints,tcontent.lastUpdate,tcontent.lastUpdateBy,tcontent.lastUpdateByID,
tcontent.MenuTitle,tcontent.MetaDesc,tcontent.MetaKeyWords,tcontent.moduleAssign,tcontent.ModuleID,tcontent.nextN,
tcontent.Notes,tcontent.OrderNo,tcontent.ParentID,tcontent.displayTitle,tcontent.ReleaseDate,tcontent.RemoteID,
tcontent.RemotePubDate,tcontent.RemoteSource,tcontent.RemoteSourceURL,tcontent.RemoteURL,tcontent.responseChart,
tcontent.responseDisplayFields,tcontent.responseMessage,tcontent.responseSendTo,tcontent.Restricted,tcontent.RestrictGroups,
tcontent.searchExclude,tcontent.SiteID,tcontent.sortBy,tcontent.sortDirection,tcontent.Summary,tcontent.Target,
tcontent.TargetParams,tcontent.Template,tcontent.Title,tcontent.Type,tcontent.subType,tcontent.Path,tcontent.tags,
tcontent.doCache,tcontent.created,tcontent.urltitle,tcontent.htmltitle,tcontent.mobileExclude,tcontent.changesetID,
tcontent.imageSize,tcontent.imageHeight,tcontent.imageWidth,tcontent.childTemplate,tcontent.majorVersion,tcontent.minorVersion,tcontent.expires,tcontent.displayInterval,tcontent.objectParams
, tfiles.fileSize,
					tfiles.contentType, tfiles.contentSubType, tfiles.fileExt,tfiles.filename as assocFilename,
				tapprovalrequests.status as approvalStatus, tapprovalrequests.requestID,tapprovalrequests.groupid as approvalGroupID
					from tcontent
					left join tfiles on (tcontent.fileid=tfiles.fileid)
					left join tapprovalrequests on (tcontent.contenthistid=tapprovalrequests.contenthistid)
					where tcontent.contentid=? 
			and tcontent.active = 1
		
					and tcontent.siteid=?
					and type in ('Page','Folder','File','Calendar','Link','Gallery','Component','Form','Variation','Module')
				
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 93109571-155D-6942-02F46FECAEE09D6F
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsExtended (Datasource=mura7, Time=2ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendData.cfc @ 13:26:25.025
			select tclassextenddata.baseid, tclassextendattributes.name, tclassextendattributes.type, tclassextendattributes.validation,
			
				tclassextendattributes.label
			,
			tclassextendattributes.attributeID,tclassextendattributes.defaultValue,tclassextendattributes.extendSetID,

			tclassextenddata.attributeValue, tclassextenddata.datetimevalue

			from tclassextenddata 
			inner join tclassextendattributes  On (tclassextenddata.attributeID=tclassextendattributes.attributeID)
			where tclassextenddata.baseID=? 
				and tclassextendattributes.siteid=? 
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = 34002954-155D-6942-02AD6D8FB10D714E
Parameter #2(cf_sql_varchar) = pearcesfurniture

rsCombine (Datasource=mura7, Time=0ms, Records=0) in C:\inetpub\wwwroot\clients\mura7\core\mura\extend\extendData.cfc @ 13:26:25.025
			select baseID, name, type, validation, label, attributeID, defaultValue, extendSetID, attributeValue
			from rsExtended

			union all

			select '' baseID, attributename as name, type, validation, label, attributeID, defaultValue, extendSetID, '' attributeValue
			from rsDefinitions
			where siteID=?
			and (
				type=? 
				)
          	and (
                 
                 subtype='Default'
                  )
			
Query Parameter Value(s) -
Parameter #1(cf_sql_varchar) = pearcesfurniture
Parameter #2(cf_sql_varchar) = Component


Scope Variables

CGI Variables:
AUTH_PASSWORD=
AUTH_TYPE=
AUTH_USER=
CERT_COOKIE=
CERT_FLAGS=
CERT_ISSUER=
CERT_KEYSIZE=256
CERT_SECRETKEYSIZE=2048
CERT_SERIALNUMBER=
CERT_SERVER_ISSUER=C=US, O=DigiCert Inc, OU=www.digicert.com, CN=RapidSSL RSA CA 2018
CERT_SERVER_SUBJECT=CN=www.pearcesfurniture.com
CERT_SUBJECT=
CF_TEMPLATE_PATH=C:\inetpub\wwwroot\clients\mura7\index.cfm
CONTENT_LENGTH=0
CONTENT_TYPE=
CONTEXT_PATH=
GATEWAY_INTERFACE=CGI/1.1
HTTPS=on
HTTPS_KEYSIZE=256
HTTPS_SECRETKEYSIZE=2048
HTTPS_SERVER_ISSUER=C=US, O=DigiCert Inc, OU=www.digicert.com, CN=RapidSSL RSA CA 2018
HTTPS_SERVER_SUBJECT=CN=www.pearcesfurniture.com
HTTP_ACCEPT=text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
HTTP_ACCEPT_ENCODING=gzip
HTTP_ACCEPT_LANGUAGE=en-US,en;q=0.5
HTTP_CONNECTION=Keep-Alive
HTTP_COOKIE=
HTTP_HOST=www.pearcesfurniture.com
HTTP_REFERER=
HTTP_USER_AGENT=CCBot/2.0 (https://commoncrawl.org/faq/)
PATH_INFO=/index.cfm
PATH_TRANSLATED=C:\inetpub\wwwroot\clients\mura7\index.cfm
QUERY_STRING=
REMOTE_ADDR=35.171.183.163
REMOTE_HOST=35.171.183.163
REMOTE_USER=
REQUEST_METHOD=GET
SCRIPT_NAME=/index.cfm
SERVER_NAME=www.pearcesfurniture.com
SERVER_PORT=443
SERVER_PORT_SECURE=1
SERVER_PROTOCOL=HTTP/1.1
SERVER_SOFTWARE=Microsoft-IIS/8.5
WEB_SERVER_API=
Cookie Variables:
MXP_TRACKINGID=D7B286D6-155D-6942-023F61DFD5BD881E
mobileFormat=false
Session Variables:
blockloginuntil=
cfid=685777
cftoken=364a11d649c5d9df-D7B28682-155D-6942-021BB20CAC711713
datekey=<script type="text/javascript">var dtExample="11/10/2024", dtCh="/", dtFormat =[0,1,2], dtLocale="en-US";</script>
datekeyformat=MM/DD/YYYY
locale=en_US
localehasdayparts=10
loginattempts=0
mura=Struct (20)
murasessionid=D7B286D6-155D-6942-023F61DFD5BD881E
muratrackingid=D7B286D6-155D-6942-023F61DFD5BD881E
rb=en_US
rememberme=0
sessionid=MURABCC3CD5A2DB8D7B8E26E41BE929C6476_685777_364a11d649c5d9df-D7B28682-155D-6942-021BB20CAC711713
siteid=pearcesfurniture
urltoken=CFID=685777&CFTOKEN=364a11d649c5d9df-D7B28682-155D-6942-021BB20CAC711713
userfilespath=/sites/pearcesfurniture/assets/
URL Parameters:
path=/pearcesfurniture//
Debug Rendering Time: 315 ms